313 results on '"Moreira, Ana Cristina"'
Search Results
152. Effect of 0.12% chlorhexidine in reducing microorganisms found in aerosol used for dental prophylaxis of patients submitted to fixed orthodontic treatment.
- Author
-
Menezes dos Santos, Isis Rodrigues, Azevedo Moreira, Ana Cristina, Cardoso Costa, Myrela Galvão, and de Castellucci e. Barbosa, Marcelo
- Subjects
ANTIBACTERIAL agents ,AEROSOL propellants ,MOUTHWASHES ,ANTISEPTICS in dentistry ,ORAL hygiene products - Abstract
Objective: This study aimed at assessing, in vivo, whether the prior use of 0.12% chlorhexidine as mouthwash would decrease air contamination caused by aerosolized sodium bicarbonate during dental prophylaxis. The study was conducted with 23 patients aged between 10 and 40 years old who were randomly selected and undergoing fixed orthodontic treatment. Methods: The study was divided into two phases (T
1 and T2 ) with a 30-day interval in between. In both phases, dental prophylaxis was performed with aerosolized sodium bicarbonate jetted to the upper and lower arches for 4 minutes. In T1 , 10 minutes before the prophylaxis procedure, the participants used distilled water as mouthwash for one minute; whereas in T2 , mouthwash was performed with 0.12% chlorhexidine. Microbial samples were collected in BHI agar plates for microbiological analysis. Two dishes were positioned on the clinician (10 cm from the mouth) and a third one at 15 cm from the patient's mouth. The samples were incubated for 48 hours at 37°C. Results were expressed in colony-forming units (CFU). Results: Statistical analysis carried out by means of Student's t test, as well as Wilconxon and Kruskal-Wallis tests revealed that the prior use of 0.12% chlorhexidine as mouthwash significantly reduced CFU in the three positions studied (P < 0.001). Conclusion: The prior use of 0.12% chlorhexidine as mouthwash significantly reduced contamination caused by aerosolized sodium bicarbonate during dental prophylaxis in the orthodontic clinic. [ABSTRACT FROM AUTHOR]- Published
- 2014
- Full Text
- View/download PDF
153. Insights on the Phytochemical Profile (Cyclopeptides) and Biological Activities of Calotropis procera Latex Organic Fractions.
- Author
-
Jucá, Thiago Lustosa, Ramos, Márcio Viana, Batista Moreno, Frederico Bruno Mendes, de Matos, Mayara Patrícia Viana, Barreto Marinho-Filho, José Delano, Moreira, Renato Azevedo, and Monteiro-Moreira, Ana Cristina de Oliveira
- Subjects
PHYTOCHEMICALS ,CYCLIC peptides ,CALOTROPIS procera ,LATEX ,ORGANIC compounds ,MEDICINAL plants - Published
- 2013
- Full Text
- View/download PDF
154. Cocontinuous morphologies in polystyrene/ethylenevinyl acetate blends: The influence of the processing temperature
- Author
-
Moreira, Ana Cristina F., Cario, Francisco O., and Soares, Bluma G.
- Abstract
The influence of the compression-molding temperature on the range of cocontinuity in polystyrene (PS)/ethylenevinyl acetate (EVA) copolymer blends was studied. The blends presented a broad range of cocontinuity when compression-molded at 160°C, and they became narrower when compression-molded at higher temperatures. A coarsening effect was observed in PS/EVA (60:40 vol %) blends upon compression molding at higher temperature with an increase in the phase size of the cocontinuous structure. Concerning PS/EVA (40:60 vol %) blends, an increase in the mixing and molding temperatures resulted in a change from a cocontinuous morphology to a dropletmatrix morphology. This effect was observed by selective extraction experiments and scanning electron microscopy. The changes in the morphology with the molding conditions affected the storage modulus. An increase in the storage modulus in blends compression-molded at 160°C was observed as a result of dual-phase continuity. An EVA copolymer with a higher vinyl acetate content (28 wt %) and a higher melt-flow index resulted in blends with a broader range of cocontinuity. This effect was more pronounced in blends with lower amounts of PS, that is, when EVA formed the matrix. © 2003 Wiley Periodicals, Inc. J Appl Polym Sci 89: 386398, 2003
- Published
- 2003
- Full Text
- View/download PDF
155. Angiopoietin-2: A Potential Mediator of the Glycocalyx Injury in Adult Nephrotic Patients.
- Author
-
Chaves, Maria Moura Santana, Mendes, Matheus de Souza, Schwermann, Maximilian Pinho, Queiroz, Raquel, Coelho, Regina Freitas, Salmito, Francisco Thiago Santos, Meneses, Gdayllon Cavalcante, Martins, Alice Maria Costa, Moreira, Ana Cristina de Oliveira Monteiro, and Libório, Alexandre Braga
- Subjects
ANGIOPOIETIN-2 ,ENDOTHELIAL growth factors ,GLYCOCALYX ,ENDOTHELIUM diseases ,NEPHROTIC syndrome ,GLOMERULAR filtration rate - Abstract
Introduction: Glomerulopathy is a group of diseases that affect mainly young adults between the ages of 20 and 40 years. Recently, it has been demonstrated that syndecan-1, a biomarker of endothelial glycocalyx damage, is increased in nephrotic patients with near-normal renal function and it is important to endothelial dysfunction in these patients. Angiopoietin-2 (AGPT2) is an endothelial growth factor that promotes cell derangement. Here we evaluated AGPT2 levels in patients with nephrotic syndrome, near-normal renal function and the possible interaction of AGPT2 with endothelial glycocalyx derangement. Methods: This was a cross-sectional study performed from January through November 2017. Adult patients (age > 18 years) with nephrotic syndrome and without immunosuppression were included. Blood samples were drawn after a 12 h fast for later measurement of syndecan-1 and AGPT2. Mediation analyses were performed to assess the hypothesized associations of nephrotic syndrome features and AGPT2 with syndecan-1. Results: We included 65 patients, 37 (56.9%) of them female, with primary glomerular disease. Syndecan-1 in nephrotic patients was higher than in control individuals (102.8 ± 36.2 vs. 28.2 ± 9.8 ng/mL, p < 0.001). Correlation of syndecan-1 with the main features of nephrotic syndrome after adjustment for age and estmmated glomerular filtration rate (eGFR) demonstrated that syndecan-1 was significantly associated with 24-h urinary protein excretion, total cholesterol, LDL (low density lipoprotein)-cholesterol, HDL (high-density lipoprotein)-cholesterol, and triglycerides. Angiopoietin-2 was independently associated with serum albumin, 24 h urinary protein excretion, total cholesterol, and LDL-cholesterol, in addition to being strongly associated with syndecan-1 (0.461, p < 0.001). The results of the mediation analyses showed that the direct association between LDL-cholesterol and syndecan-1 was no longer significant after AGPT-2 was included in the mediation analysis. AGPT2 explained 56% of the total observed association between LDL-cholesterol and syndecan-1. Conclusion: The association between LDL-cholesterol and glycocalyx derangement in nephrotic patients is possibly mediated by AGPT2. [ABSTRACT FROM AUTHOR]
- Published
- 2018
- Full Text
- View/download PDF
156. Suplementação na osteoartrite e seus efeitos histopatológicos : revisão sistemática
- Author
-
Soares, Sérgio Lopes, Moreira, Ana Cristina de Oliveira Monteiro, Medeiros, Maria Angelina Silva, Rodrigues, Carlos Ewerton Maia, Cavalcante, Marcelo Borges, and Sousa, Felipe Domingos de
- Subjects
Saúde suplementar ,Osteoartrite - Abstract
Made available in DSpace on 2022-06-23T00:26:15Z (GMT). No. of bitstreams: 0 Previous issue date: 2021-07-29 Introduction: Osteoarthritis (OA), is one of the most common chronic diseases affecting a large part of the world population. It currently affects more than 303 million people in the world, becoming a serious public health problem for countries. Objective: To verify the effect of supplements on the progression of OA in animal models. Methods: The systematic review of articles in english followed the PRISMA guidelines using the Pubmed, ScienceDirect, Web of Science, Scopus and Google Scholar databases from 2010 to 2021. The 205 eligible articles were analyzed using the PICO strategy, where the participants had OA, the intervention by different oral supplements, the comparison for non-supplementation and the outcome was the chondroprotection of OA assessed by the validated semiquantitative histopathological scores. Results: of the 33 eligible works, 79% had a chondroprotective action in OA. The most researched supplement was glucosamine sulfate present in 6 articles. Of the 12 studies that used glucosamine, associated or not with chondroitin, 75% had a chondroprotective effect. Of the 3 articles that used hydrolyzed collagen/peptides, none had significance. The 2 of shea nut and 2 of isolated chondroitin showed 100% efficacy in the chondroprotective action. Another 19 supplements were also found in this review. The most used score was the OARSI with 17 studies. Conclusion: supplements are able to protect joint cartilage from OA pathology, reducing degradation, inhibiting the inflammatory process, improving pain and joint function. Keywords: osteoarthritis, nutritional supplements, histology, treatment, nutraceuticals Introdução: A Osteoartrite (OA), é uma das mais comuns doenças crônicas afetando grande parte da população mundial. Atualmente afeta mais de 303 milhões de pessoas no mundo, se tornando um sério problema de saúde pública para os países. Objetivo: Verificar o efeito dos suplementos na progressão da OA em modelos animais. Métodos: A revisão sistemática de artigos em inglês seguiu conforme as diretrizes do PRISMA utilizando as bases Pubmed, ScienceDirect, Web of Science, Scopus e Google Scholar de 2010 a 2021. Os 205 artigos elegíveis foram analisados por meio da estratégia PICO, onde os participantes tinham OA, a intervenção por diferentes suplementos orais, o comparador por não suplementação e o outcome (desfecho) era a condroproteção da OA avaliada pelos escores histopatológicos semiquantitativos validados. Resultados: dos 33 trabalhos elegíveis 79% apresentaram ação condroprotetora na OA. O suplemento mais pesquisado foi o sulfato de glicosamina presente em 6 artigos. Dos 12 trabalhos que utilizaram glicosamina, associada ou não a condroitina, 75% tiveram efeito condroprotetor. Dos 3 artigos que utilizaram colágeno hidrolisado/peptideos, nenhum obteve significância. Já os 2 de nóz de carité e 2 de condroitina isolada apresentaram 100% de eficácia na ação condroprotetora. Outros 19 suplementos também foram encontrados nesta revisão. O escore mais utilizado foi o OARSI com 17 estudos. Conclusão: os suplementos são capazes de proteger a cartilagem articular na patologia da OA, reduzindo a degradação, inibindo o processo inflamatório, melhorando a dor e a função articular. Palavras-chave: osteoartrite, suplementos nutricionais, histologia, tratamento, nutracêuticos
- Published
- 2021
157. Exercícios fisioterapêuticos em pacientes com artrite reumatóide e qualidade de vida : uma revisão sistemática
- Author
-
Martins, Ana Clécia de Oliveira, Moreira, Ana Cristina de Oliveira Monteiro, Viana, Carolina de Araujo, Rodrigues, Carlos Ewerton Maia, and Vieira Neto, Antônio Eufrásio
- Subjects
Dor ,Artrite reumatoide ,Fisioterapia - Abstract
Made available in DSpace on 2022-06-23T00:20:49Z (GMT). No. of bitstreams: 0 Previous issue date: 2021-02-11 Introduction: Rheumatoid Arthritis has a prevalence of approximately 1% of the world population, being thus a very common systemic autoimmune disease (AID). In Brazil, the prevalence ranges from 0.2% to 1% of the population. For many years RA has been seen as a benign pathology, but more recent research has shown that, as a result of its deleterious effects, which include the physical and functional capacity of affected individuals, physical mobility and the durability of the inflammatory process (atherosclerosis accelerated), individuals with RA have a lower quality and life expectancy when compared to the general population. Objective: to evaluate the impact of physical therapy exercises in patients with rheumatoid arthritis on patients' quality of life. Methodology: This is an integrative systematic review study, where articles from the electronic database PubMed were consulted manually, from January 2010 to December 2020. Articles were selected based on the keywords Rheumatoid Arthritis , Phisioterapy Exercises and Quality of life, all according to the Health Science (DeCS) descriptors. The terms were cross-checked using the Boolean operator ¿AND¿. The research included articles that characterized the theme ¿physical therapy exercises in the quality of life of individuals with RA. Results: 51 articles were found in the database, of which 05 articles were selected that met the inclusion criteria. Conclusion: The study demonstrated that physical therapy exercises, more specifically kinesiotherapeutic exercises, associated or not with other techniques, have an excellent cost-benefit and improve the quality of life of people with RA. It was observed that with the use of these techniques there was an improvement in the function of the hands, an improvement in the pain and they also interfered in the non-worsening of the disease, having an excellent cost-benefit and improving the quality of life of people with RA. Keywords: Rheumatoid arthritis; physical therapy exercises; quality of life; ache. Introdução: A Artrite Reumatóide tem uma prevalência de aproximadamente 1% da população mundial, sendo dessa forma uma doença autoimune (DAI) sistêmica muito comum. No Brasil, a prevalência varia de 0,2% a 1% da população. Por muitos anos a AR foi vista como uma patologia de característica benigna, porém pesquisas mais recentes eidenciaram que, em consequência de seus efeitos deletérios, que abrangem a capacidade física e funcional dos indivíduos afetados, a mobilidade física e a durabilidade do processo inflamatório (aterosclerose acelerada), os indivíduos com AR têm sua qualidade e expectativa de vida menor quando comparados com a população geral. Objetivo: avaliar qual o impacto dos exercícios fisioterapêuticos em pacientes com artrite reumatóide na qualidade de vida dos pacientes. Metodologia: Este é um estudo do tipo revisão sistemática integrativa, onde foram consultados, de forma manual, artigos da base de dados eletrônicos PubMed, no período de janeiro de 2010 a dezembro de 2020. Foram selecionados artigos a partir das palavras-chave Rheumatoid Arthritis, Phisioterapy Exercises e Quality of life, todos de acordo com os descritores de Ciência da Saúde (DeCS). O cruzamento dos termos foi realizado através do operador boleano ¿AND¿. Foram incluídos na pesquisa artigos que caracterizassem o tema ¿exercícios fisioterapêuticos na qualidade de vida de indivíduos com AR. Resultados: Foram encontrados 51 artigos na base de dados, dos quais foram selecionados 05 artigos que se enquadraram nos critérios de inclusão. Conclusão: O estudo demonstrou que os exercícios fisioterapêuticos, mais especificamente os cinesioterapêuticos, associados ou não a outras técnicas tem um ótimo custo-benefício e melhororam a qualidade de vida de pessoas com AR. Foi observado que com o uso destas técnicas houve melhora da função das mãos, melhora do quadro álgico e ainda interferiram para o não agravamento da doença, tendo um ótimo custo-benefício e melhororando a qualidade de vida de pessoas com AR. Palavras-chave: Artrite Reumatóide; exercícios fisioterapêuticos; qualidade de vida; dor.
- Published
- 2021
158. Análise do perfil proteico por espectrometria de massasde plasma sanguíneoe músculo de ratos após aplicação de um protocolo de mobilização precoce
- Author
-
Almeida, Raissa Magalhães de, Moreira, Ana Cristina de Oliveira Monteiro, Moreira, Renato de Azevedo, and Vieira Neto, Antônio Eufrásio
- Subjects
Sistema músculo-esquelético - Fisioterapia ,Espectometria de massas ,Atrofia muscular - Abstract
Made available in DSpace on 2022-06-23T00:17:32Z (GMT). No. of bitstreams: 0 Previous issue date: 2021-01-29 The skeletal muscular system is totally adaptable, as it presents itself in a continuous period of remodeling, responding quickly to use and disuse through changes in its diameter, length, type of contractile fibers and vascular irrigation. Research reports that after 4 hours of bed rest, there is a reduction in the amount of sarcomeres and shortening of muscle fibers, with a consequent loss of muscle contraction strength. The study aimed to evaluate the possible impacts of molecular changes resulting from the application of an early mobilization protocol in rats. The animals were divided into three groups, where group N received no intervention, group NM received anesthetic and inflammatory induction, remained with immobilized limb based on a protocol for five days and group M that received anesthetic and inflammatory induction, immobilization protocol and after four hours an early mobilization protocol. At the end of the treatment, blood plasma was collected and the quadriceps muscle was dissected. Then, the blood protein profile was analyzed by electrophoresis in polyacrylamide gel under denaturing conditions - PAGE-SDS and mass spectrometry (LC-MS) and the muscle protein profile by mass spectrometry (LC-MS). We can conclude that when analyzing the muscle tissue, the group that received the PM protocol had more proteins expressed and in relation to blood plasma it was noticed that this protocol was able to increase the circulation of proteins responsible for the inflammatory process, however when comparing the proteins responsible for the contraction process, these were more present, despite the little difference, in the group that did not receive the early mobilization protocol. Keywords: Early mobilization, Physical Therapy, Electrophoresis, Mass Spectrometry, Proteins, Wistar Rats. O sistema muscular esquelético é totalmente adaptável, pois se apresenta em um período contínuo de remodelação respondendo rapidamente ao uso e ao desuso através das alterações do seu diâmetro, comprimento, tipo de fibras contráteis e irrigação vascular. Pesquisas relatam que após 4 horas de repouso no leito, há redução da quantidade de sarcômeros e encurtamentos de fibras musculares, com consequente perda da força de contração muscular. O estudo teve como objetivo avaliar os possíveis impactos das alterações moleculares decorrentes da aplicação de um protocolo de mobilização precoce em ratos. Os animais foram divididos em três grupos, onde o grupo naive (N) não recebeu intervenção, o grupo não mobilizado (NM) recebeu indução anestésica e inflamatória, permaneceu com um membro posterior imobilizado, baseado em um protocolo por cinco dias, e o grupo mobilizado (M) que recebeu indução anestésica e inflamatória, protocolo de imobilização e após quatro horas um protocolo de mobilização precoce. No final do tratamento, o plasma sanguíneo foi coletado e o músculo quadríceps foi dissecado. Em seguida, foi realizada a análise do perfil protéico sanguíneo, onde as proteínas foram obtidas por meio de eletroforese em gel de poliacrilamida em condições desnaturantes - PAGE-SDS e em seguida analisadas por espectrometria de massas (LC-MS) e também do perfil proteico muscular, cujas proteínas foram obtidas por protocolo de congelamento/descongelamento/maceração e tampão desnaturante e posteriormente analisadas por espectrometria de massas (LC-MS). Podemos concluir que ao analisar o tecido muscular, o grupo que recebeu o protocolo de MP teve mais proteínas expressas e em relação o plasma sanguíneo percebeu-se que esse protocolo foi capaz de aumentar a circulação de proteinas responsáveis pelo processo inflamatório, porém ao compararmos as proteínas responsáveis pelo processo de contração, essas foram mais presentes, apesar da pouca diferença, no grupo que não recebeu o protocolo de mobilização precoce. Palavras-chave: Mobilização precoce; Fisioterapia; Eletroforese; Espectrometria de massas; Proteínas; Ratos wistar.
- Published
- 2021
159. Evaluation of polyethylene crystallization kinetics: effect of long branching and thermo-oxidative degradation
- Author
-
Fragoso, Julyana Ferro, Andrade, Mônica Calixto de, Moreira, Ana Cristina Fontes, Costa, Helson Moreira da, and Silva, Ana Lúcia Nazareth da
- Subjects
Thermal properties ,Reaproveitamento (Sobras, refugos, etc.) ,Isothermal and non-isothermal crystallization kinetics ,Polimeros Biodegradação ,Polietileno Reaproveitamento ,mPELBD ,Reciclagem ,Propriedades térmicas ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA::MATERIAIS NAO METALICOS [CNPQ] ,DSC ,Polietileno - Propriedades térmicas ,Cristalização ,Recycling ,mLLDPE ,Cinética de cristalização isotérmica e não isotérmica - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:00Z No. of bitstreams: 1 Dissertacao_JulyanaFerroFragoso.pdf: 2308279 bytes, checksum: 4da0c7bd193c2f4e6831d7acb2d3af62 (MD5) Made available in DSpace on 2021-01-05T18:30:00Z (GMT). No. of bitstreams: 1 Dissertacao_JulyanaFerroFragoso.pdf: 2308279 bytes, checksum: 4da0c7bd193c2f4e6831d7acb2d3af62 (MD5) Previous issue date: 2019-07-11 The problem of polymeric materials disposal has been made worrying due to the high decomposition time of these materials. Recycling of polymers is an important factor, since discarded materials may be returned return to the market in new forms and with different applications. This work aims to evaluate the linear low density metallocene polyethylene (mPELDB) samples crystallization process, submitted to multiple extrusions and exposure to ultraviolet radiation. Two types of mPELBD were used: the conventional one, presenting only short branches and the "easy to process", which has short and long branches. The multiple extrusions process is a known method used to simulate the reprocessing of polymeric materials, evaluating the impact of thermo mechanical degradation on material. Exposure to ultraviolet radiation has the aims to simulate the material exposure to the weather, and thus, to evaluate the decomposition degree of material post consumption. The evaluations were performed through crystallization kinetics study of virgin polyethylene, multiprocessed and exposed to UV radiation. Polyethylene is a material widely used in flexible packaging, where weldability is an considered an important property. The polyethylene solidification in the weld is strongly dependent on crystallization behavior, so the focus of this work was to evaluate the long branches effect on the kinetics of isothermal and nonisothermal crystallization in polyethylene samples treated by capable simulating processes of primary and secondary recycling. This study was performed by Exploratory Differential Calorimetry (DSC). In isothermal crystallization kinetics the samples are subjected to various heating processes, followed by rapid cooling and isotherms of 109°C, 107°C, 105°C and 103°C. These results are analyzed based on Avrami's Theory. In non-isothermal crystallization kinetic the samples are heated at a given temperature, kept for 5 minutes and cooled at rates of 2.5; 5; 7.5 and 10°C/min. The modified Ozawa Theory by the Jeziorny Model and the Mo Theory are used for non-isothermal crystallization kinetics analysis. O problema de descarte de materiais poliméricos tem se tornado preocupante devido ao elevado tempo de decomposição desses materiais. A reciclagem de polímeros é um fator importante, uma vez que materiais descartados podem retornar ao mercado sob novas formas e com diversas aplicações. Este trabalho tem como objetivo avaliar o processo de cristalização de amostras de polietileno metalocênico linear de baixa densidade (mPELDB), submetidos a múltiplas extrusões e exposição à radiação ultravioleta. Foram empregados dois tipos de mPELBD: o convencional, apresentando apenas ramificações curtas e o de fácil processamento , que possui ramificações curtas e longas. O processo de múltiplas extrusões é um método utilizado para simular o reprocessamento de materiais poliméricos, avaliando o impacto da degradação termo mecânica no material. A exposição à radiação ultravioleta tem como objetivo simular a exposição do material às intempéries e, desta forma, avaliar o grau de decomposição do material pós-consumo. As avaliações foram realizadas através do estudo da cinética de cristalização do polietileno virgem, multiprocessado e exposto à radiação UV. O polietileno é um material amplamente empregado em embalagens flexíveis, onde a soldabilidade é considerada uma propriedade importante. A solidificação do polietileno na solda é fortemente dependente do comportamento de cristalização, portanto o enfoque deste trabalho foi avaliar o efeito das ramificações longas na cinética de cristalização, isotérmica e não isotérmica, nas amostras de polietileno tratadas por processos capazes de simular as reciclagens primária e secundária. Este estudo foi realizado por Calorimetria Diferencial Exploratória (DSC). Na cinética de cristalização isotérmica as amostras são submetidas a diversos processos de aquecimento, seguidos de um rápido resfriamento e isotermas de 109°C, 107°C, 105°C e 103°C. Os resultados são analisados com base na Teoria de Avrami. Na cinética de cristalização não isotérmica as amostras são aquecidas a uma dada temperatura, mantidas por 5 minutos e resfriadas a taxas de 2,5; 5; 7,5 e 10°C/min. A Teoria de Ozawa modificada pelo modelo de Jeziorny e a Teoria de Mo, são utilizadas para análise da cinética de cristalização não isotérmica.
- Published
- 2019
160. Analysis of behavior of recycled polyamide 11 used as automotive coting
- Author
-
Fernandes, Carina dos Santos, Andrade, Mônica Calixto de, Moreira, Ana Cristina Fontes, Sirqueira, Alex da Silva, and Costa, Helson Moreira da
- Subjects
Tribology ,Revestimentos protetores ,Reaproveitamento (Sobras, refugos, etc.) ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA::MATERIAIS NAO METALICOS::POLIMEROS, APLICACOES [CNPQ] ,Reciclagem ,Poliamidas Reaproveitamento ,Poliamida 11 ,Kinetics ,Cinética ,Tribologia ,Desgaste mecânico ,Wear ,Revestimento de plástico ,Recycling ,Cristalinidade ,Crystallinity ,Polyamide 11 - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:29:51Z No. of bitstreams: 1 Dissertacao_CarinaDosSantosFernandes.pdf: 2448664 bytes, checksum: 98631c833a9b8dfc254148af14388f9e (MD5) Made available in DSpace on 2021-01-05T18:29:51Z (GMT). No. of bitstreams: 1 Dissertacao_CarinaDosSantosFernandes.pdf: 2448664 bytes, checksum: 98631c833a9b8dfc254148af14388f9e (MD5) Previous issue date: 2019-02-07 Fundação Carlos Chagas Filho de Amparo a Pesquisa do Estado do Rio de Janeiro Polyamide 11 is a polymer widely used for coating slip interfaces to protect against friction wear, since it has a good combination of chemical, thermal and mechanical properties. The automotive industry uses parts coated with melted polyamide in the form of a continuous coating. This work evaluates the viability of the primary recycling of waste from the machining of polyamide 11 used as a coating, in the form of mixtures with the virgin polymer, in the proportions of 100/0, 85/15 and 75/25 virgin and recycled PA11, respectively. The methods of characterization of virgin and recycled samples and their combinations are based on thermal analyzes (thermogravimetric and differential scanning calorimetry), hardness, roughness and adhesion analysis, as well as tribological wear analyzes. The isothermal and non-isothermal crystallization kinetics of the virgin and recycled polyamide 11 indicated that the crystallization rate of the recycled material is higher than the virgin material. Melting and degradation temperatures were maintained for both materials. The uniformity and adhesion of the coating were satisfactory, keeping in line with the parameters required for the automotive application. The technique of analysis of the infrared absorption region (FTIR) showed that there was no damage to the polymer binding. The tribological analysis showed a different behavior for the two antagonist body roughness s employed. The incorporation of recycled material decreased wear and maintained the coefficient of friction. The primary recycling of the polyamide residue 11 is feasible and its use reduces the cost with the raw material and the damages caused by the inadequate disposal of this residue. A poliamida 11 é um polímero largamente utilizado para recobrimento de interfaces de deslizamento visando à proteção contra o desgaste sofrido pelo atrito, uma vez que apresenta uma boa combinação de propriedades químicas, térmicas e mecânicas. A indústria automotiva utiliza peças recobertas com poliamida fundida, na forma de um revestimento contínuo. Este trabalho avalia a viabilidade da reciclagem primária dos resíduos da usinagem da poliamida 11 utilizada como revestimento, na forma de misturas com o polímero virgem, nas proporções de 100/0, 85/15 e 75/25 de PA11 virgem e reciclada, respectivamente. Os métodos de caracterização das amostras virgem e reciclada, e suas combinações são baseados em análises térmicas (termogravimétrica e calorimetria diferencial de varredura), em análises de dureza, rugosidade e aderência, além de análises de desgaste por tribologia. A cinética de cristalização, isotérmica e não isotérmica, da poliamida 11 virgem e reciclada indicou que a taxa de cristalização do material reciclado é maior do que o material virgem. As temperaturas de fusão e degradação foram mantidas para ambos os materiais. A uniformidade e a aderência do revestimento foram satisfatórias, mantendo-se de acordo com os parâmetros exigidos para a aplicação automotiva. A técnica de análise da região de absorção no infravermelho (FTIR) mostrou que não houve danos na ligação do polímero. A análise tribológica mostrou um comportamento diferente para as duas rugosidades de contracorpo empregado. A incorporação do reciclado diminuiu o desgaste e manteve o coeficiente de atrito. A reciclagem primária do resíduo de poliamida 11 é viável e sua utilização reduz o custo com a matériaprima e os danos causados pelo descarte inadequado deste resíduo.
- Published
- 2019
161. Estudo das estruturas cristalinas e micrografias de vitrocerâmicas produzidas a partir de vidro com adição de Nb2O5
- Author
-
Rocha, Pedro Martins, Andrade, Mônica Calixto de, Gonçalves, Maria Clara Henriques Baptista, Moreira, Ana Cristina Fontes, and Silva, Ana Lúcia Nazareth da
- Subjects
Refugo de vidro Reaproveitamento ,Ceramics ,Resíduos de vidro Reaproveitamento ,Reaproveitamento (Sobras, refugos, etc.) ,Vitrocerâmicos ,Ceramica vitrificada ,Vitroceramics ,Automóveis - Janelas e para-brisas Reaproveitamento ,Nióbio ,Indústria de reciclagem ,Cerâmica ,ENGENHARIAS::ENGENHARIA QUIMICA::TECNOLOGIA QUIMICA::CERAMICA [CNPQ] ,Fases Cristalinas ,Cristalização ,Glass ,Crystal Phases ,Crystallization ,Nb2O5 - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:29:56Z No. of bitstreams: 1 Dissertacao_PedroMartinsRocha.pdf: 3865369 bytes, checksum: ed7a4c925b0e5532b3273d4423c3b6ee (MD5) Made available in DSpace on 2021-01-05T18:29:56Z (GMT). No. of bitstreams: 1 Dissertacao_PedroMartinsRocha.pdf: 3865369 bytes, checksum: ed7a4c925b0e5532b3273d4423c3b6ee (MD5) Previous issue date: 2019-02-06 Glass-ceramic materials, from the glass powder of windshield, were produced and characterized. Two compositions were studied, the composition of the windshield glass powder itself, Si2O-Na2O-CaO-MgO-Al2O3, and another with 10% niobium pentoxide, Nb2O5, in this system. The powders were characterized by X-ray fluorescence spectrometry and laser scattering particle size distribution to determine the powder particle size of the samples. The parts were sintered at 650 ° C, 700 ° C, 750 ° C and 800 ° C. Each batch of parts was evaluated linear retraction, apparent porosity and scanning electron microscopy, SEM. We also performed X-ray diffraction, X-ray excited photoelectron spectroscopy, XPS; spectroscopy in the infrared region and Raman scattering vibration spectroscopy. The difference in crystalline structures and glass ceramic micrographs were observed with and without addition of 10% Nb2O5. The densification of the pieces remains constant until the temperature of 750 ºC, beginning to decrease after 800 ºC. The addition of niobium oxide favored the formation of the crystalline structures of Isolueshita and Zeolite at 700 ºC. It also showed a higher amount of crystals, with higher sodium content and lower calcium content. This indicates a higher incorporation of the hydroxides of the primary elements (Nb / Si) and (Na / Si), during the heat treatment, allowing the development of crystalline structures inside the glass matrix and consequently typical spectra of more crystalline structures. The Nb2O5 also favored the control of the dimensions in the samples, resulting in a lower variation of values in the linear retraction of the glass-ceramic materials. Materiais vitrocerâmicos, a partir do pó de vidro de para-brisa, foram produzidos e caracterizados. Duas composições foram estudadas, a composição do próprio pó de vidro do para-brisa, Si2O-Na2O-CaO-MgO-Al2O3, e uma outra com adição de 10 % de pentóxido de nióbio, Nb2O5, neste sistema. Os pós foram caracterizados por espectrometria de fluorescência de raios X e distribuição granulométrica com dispersão a laser para determinar a granulometria do pó das amostras . As peças foram sinterizadas em 650 ºC, 700 ºC, 750 ºC e 800 ºC. Cada lote de peças foi avaliado a retração linear, a porosidade aparente e microscopia eletrônica de varredura, MEV. Também foi realizado difração de raios X, espectroscopia de fotoelétrons excitados por raios X, XPS; espectroscopia na região do infravermelho e espectroscopia vibracional de espalhamento Raman. A diferença nas estruturas cristalinas e nas micrografias das vitrocerâmicas foram observadas com e sem adição de 10% de Nb2O5. A densificação das peças permanece constante até a temperatura de 750 ºC, começando a diminuir após 800 ºC. A adição do óxido de nióbio favoreceu a formação das estruturas cristalinas de Isolueshita e Zeolita a 700 ºC. Como também mostrou uma maior quantidade de cristais, com maior teor de sódio e menor teor de cálcio. O que indica uma incorporação superior dos hidróxidos dos elementos primários (Nb/Si) e (Na/Si), durante o tratamento térmico, possibilitando o desenvolvimento de estruturas cristalinas no interior da matriz vítrea e consequentemente espectros típicos de estruturas mais cristalinas. O Nb2O5 também favoreceu o controle das dimensões nas amostras, resultando em uma menor variação de valores na retração linear dos materiais vitrocerâmicos.
- Published
- 2019
162. Análise proteômica do plasma de pacientes portadores de diabetes mellitus acometidos por acidente vascular cerebral isquêmico
- Author
-
Nogueira, Diana Lima, Moreira, Ana Cristina de Oliveira Monteiro, Moreira, Renato de Azevedo, and Lobo, Marina Duarte Pinto
- Subjects
Proteômica ,Diabetes mellitus ,Acidente Vascular Cerebral - Abstract
Made available in DSpace on 2022-06-23T00:04:16Z (GMT). No. of bitstreams: 0 Previous issue date: 2019-01-31 Introduction: Stroke, refers to the rapid development of signs of focal and global disorders of cerebral function of vascular origin and can be divided into two main groups, hemorrhagic stroke (hC) and ischemic stroke (iC). which both cause a blood flow deprivation. Stroke may be related to several risk factors among them or Diabetes Mellitus (DM), which is a metabolic abnormality of lipids, lipids and proteins, being an increase in blood glucose level with greater repercussion for humans. There are several mechanisms by which diabetes leads to stroke, including endothelial vascular dysfunction, increased early arterial stiffness, systemic inflammation, and thickening of the capillary basement membrane. Based on the performance of proteins in the physiological functions of cells, the importance of studying protein elevation in stroke and diabetes patients is evident. These pathologies have a variety of alterations related to their alterations. Objective: To perform a protein analysis of the plasma of patients with diabetes mellitus affected by ischemic stroke. Methodology: This is a laboratory research that analyzes or protein profile of patients with diabetes mellitus affected by vascular ischemic stroke. stroke patients and the control group. One sample consisted of 30 participants divided into three groups of 10 (10 patients with DM with stroke, 10 patients with stroke and 10 in the control group). Two blood samples were collected for protein analysis. Results: A sample from the stroke group was composed of 60% female and 40% male patients, with a mean age of 76.7 ± 14.49. All patients in this group had systemic arterial hypertension as a risk factor and 20% of them were smokers. The group of patients with DM who suffered stroke was mostly men, representing 70% of the sample. The average age of this group was 71.5 ± 14.78 and all presented in the DM as a risk factor. In addition, 80% of the sample was hypertensive and 20% smoker. It was concluded that a group of stroke patients had a high protein level and no atherosclerosis process. The group with Diabetes Mellitus that suffers stroke, in addition to presenting an increased expressiveness of substances produced by coagulants, also exhibits proteins that present hyperglycemia, as they cause alterations in the firbinolytic system and the control group that affects the expressiveness of substances. related to the immune system, with anti-adhesion, antiplatelet aggregation and antithrombosis properties. Keywords: Proteomics; Stroke; Diabetes Mellitus. Introdução: O Acidente Vascular Cerebral (AVC), refere-se ao desenvolvimento rápido de sinais clínicos de distúrbios focais e ou globais da função cerebral de origem vascular e pode ser dividido em dois grupos principais, AVC hemorrágico (AVCh) e isquêmico (AVCi), sendo que, ambos ocasionam a privação do fluxo sanguíneo. O AVCi pode estar relacionado a diversos fatores de riscos entre eles o Diabetes Mellitus (DM), que é uma anormalidade metabólica dos glicídios, lipídeos e proteínas, sendo a elevação no nível glicêmico no sangue a de maior repercussão para o ser humano. Existem vários mecanismos pelos quais o diabetes leva ao acidente vascular cerebral, incluindo disfunção endotelial vascular, aumento da rigidez arterial precoce, inflamação sistêmica e espessamento da membrana basal capilar. Mediante o desempenho das proteínas nas funções fisiológicas das células, evidencia-se a importância de estudar a elevação das proteínas em pacientes portares de AVCi e diabetes, visto que essas patologias tem uma variedade de proteínas relacionadas a suas alterações. Objetivo: realizar a análise proteômica do plasma de pacientes portadores de diabetes mellitus acometidos por acidente vascular cerebral isquêmico Metodologia: Trata-se de uma pesquisa laboratorial, que analisou o perfil proteômico dos pacientes portadores de diabetes mellitus acometidos por acidente vascular cerebral isquêmico, comparando com os portadores de AVCi e com o grupo controle. A amostra foi composta por 30 participantes divididos em três grupos de 10 (10 pacientes portadores de DM com AVCi, 10 pacientes com AVCi e 10 no grupo controle). Foram coletadas duas amostras de sangue para a análise proteômica. Resultados: A amostra do grupo AVCi foi composta por 60% de pacientes do sexo feminino e 40% do sexo masculino, a média de idade foi 76,7 ± 14,49. Todos os pacientes deste grupo apresentava como fator de risco a hipertensão arterial sistêmica e 20% deles era tabagista. O grupo portador de DM que sofreu AVCi era composto em sua maioria por homens, representando 70% da amostra. A média de idade deste grupo foi de 71,5 ± 14,78 e todos apresentavam o DM como fator de risco, além disso 80% da amostra era hipertensa e 20% tabagista. Conclui-se que o grupo de pacientes que sofreu AVCi apresentou nível elevado de proteínas envolvidas no processo de aterosclerose. O grupo portador de Diabetes Mellitus que sofreu AVCi, além de apresentar aumento da expressividade de proteínas pró-coagulantes, também apresentou proteínas que na presença de hiperglicemia causam alterações no sistema firbinolítico e o grupo controle apresentou aumento na expressividade de proteínas relacionadas ao sistema imunológico, com propriedades de antiadesão, agregação antiplaquetária e antitrombose. Palavras-chave: Proteômica; Acidente Vascular Cerebral; Diabetes Mellitus.
- Published
- 2019
163. Plant Macromolecules as Biomaterials for Wound Healing
- Author
-
De Sousa, Felipe, Lourenzoni, Marcos Roberto, Diógenes De Oliveira-Filho, Rosueti, Rolim Campos, Adriana, De Azevedo Moreira, Renato, De Oliveira Monteiro-Moreira, Ana Cristina, Eufrásio Vieira-Neto, Antônio, De Oliveira Nunes, Marília, and De Fátima Goebel De Souza, Tamiris
- Subjects
Medical - Abstract
Natural biomolecules are increasingly relevant for biomedical applications and tissue engineering for being able to produce an effect on chemical signals, organization of cells, and restitution of extracellular matrix in lesioned tissues. In this chapter, we will address the potential of plant macromolecules, in particular, carbohydrates and proteins such as hemicelluloses and lectins. While lectins are mostly carbohydrate-binding proteins, which can interact with cell surfaces to initiate anti-inflammatory pathways, as well as immunomodulatory functions, hemicelluloses are remarkably known by their ability to form viscous solutions even at low concentrations, which makes them an excellent candidate as vehicle to carry different sorts of biomolecules. Taking into account the complexity of the whole healing process, as an overlapping and coordinated cascade of events, most of the properties presented here by those materials may be of interest to the wound-care market.
- Published
- 2019
164. Novos biomarcadores de lesão endotelial em pacientes com síndrome nefrótica : papel da angiopoietina-2
- Author
-
Chaves, Maria Moura Santana, Moreira, Ana Cristina de Oliveira Monteiro, Liborio, Alexandre Braga, Silva Júnior, Geraldo Bezerra da, Moreira, Renato de Azevedo, and Custódio, Charllyany Sabino
- Subjects
Nefrologia ,Biomarcadores ,Glomérulos renais - Abstract
Made available in DSpace on 2022-06-23T00:04:20Z (GMT). No. of bitstreams: 0 Previous issue date: 2018-12-07 Introduction: Glomerulopathies are diseases that mainly affect young adults between 20 and 40 years. Recently, serum levels of syndecan-1, a biomarker of endothelial glycocalyx damage, have been shown to be increased in nephrotic patients with mild loss of renal function and is important for endothelial dysfunction in these patients. In this study, we assessed the level of angiopoietin-2 syndrome (PTGA2) in patients with nephrotic syndrome and near normal renal function and its possible interaction with endothelial glycocalyx derangement. Objective: To evaluate the new biomarkers and endotelial lesion in patients with nephrotic syndrome and the role of nephrotic endothelial-angiopioetin-2 syndrome. Method: A cross-sectional study conducted from January to November 2017. Adult patients (age> 18 years) with nephrotic syndrome and without immunosuppression were included. Samples of blood after 12 h fasting for further measurement of syndecan-1 and AGPT2. Mediation analyzes were performed to evaluate the hypothetical associations of nephrotic syndrome and AGPT2 syndrome with syndecan-1. Results: 65 patients were included, of which 37 (56.9%) were females with primary glomerular disease. The levels of Syndecan-1 in nephrotic patients were higher than in the control group (102.8 ± 36.2 vs. 28.2 ± 9.8 ng / mL, p 18 anos) com síndrome nefrótica e sem imunossupressão. As amostras de sangue após jejum de 12 h para posterior mensuração de syndecan-1 e AGPT2. Análises de mediação foram realizadas para avaliar as associações hipotéticas de características da síndrome nefrótica e AGPT2 com syndecan-1. Resultados: Foram incluídos 65 pacientes, sendo 37 (56,9%) do sexo feminino com doença glomerular primária. Os níveis de syndecan-1 em pacientes nefróticos foram maiores que no grupo controle (102,8 ± 36,2 vs. 28,2 ± 9,8 ng/mL, p
- Published
- 2018
165. Perfil diferencial sérico de paciente em tratamento para melioidose : um estudo de caso
- Author
-
Neto, José Baptista de Sant'Ana, Rolim, Dionne Bezerra, Moreira, Ana Cristina de Oliveira Monteiro, and Lobo, Marina Duarte Pinto
- Subjects
Biomarcadores ,Melioidose - Abstract
Made available in DSpace on 2022-06-22T23:52:24Z (GMT). No. of bitstreams: 0 Previous issue date: 2018-01-31 Melioidosis is a non-contagious infectious disease caused by the Gram-negative bacterium Burkholderia pseudomallei, with a greater number of cases occurring mainly in Northeast of Thailand and North of Australia, already in Brazil it permeates all the State of Ceará although its extension is not known with precision in the country. It can evolve asymptomatically, acutely with sepsis until chronification. It mimics numerous other diseases, which due to lack of clinical and laboratory knowledge are erroneously identified. In view of its high morbidity and mortality aggravated when it occurs with risk factors such as diabetes mellitus, which is especially potentiating the disease, the need for an efficient diagnosis is necessary, where time is the main obstacle, given the delay in generating - a result is obtained by the commonly used assays. Being the mass spectrometry and its other approaches, tool of improvement of the results, having great prominence that refers to the sensitivity, precision and speed of analysis, allowing the identification of thousands of proteins, through the analysis of qualitative - quantitative differential expression of protein profiles in different samples. Therefore, from this scenario, the elaboration of this study is justified when it is necessary to add another analytical method, which improves the laboratory diagnosis and consequently broadens the research options, which aim to subsidize clinical management, in the form of a characteristic protein profile of the disease, supporting better approaches to allow the correct and early diagnosis of melioidosis. The cross-sectional study led to a protein profile from a clinical serum sample, confirmed for melioidosis, obtained at different moments of the pharmacotherapeutic follow-up, elucidating a possible protein panel for this infection, through a differential analysis of the proteins expressed through the technique ESI-TOF/MS. Differentially expressed acute-chronic phase proteins were detected. It was concluded that the technique used here was useful to detect a protein profile of interest in the clinical course, aiming to reduce the response time to the therapeutic approach, however, more studies are needed as more patients to investigate other expressed proteins, as well as from the perspective of the pathogen, further expanding knowledge and improving databases that involve melioidosis. Keywords: Melioidosis. Biomarkers. Mass Spectrometry. A melioidose é uma doença infecciosa não contagiosa causada pela bactéria Gram-negativa Burkholderia pseudomallei, com maior número de casos ocorrendo principalmente no Nordeste da Tailândia e Norte da Austrália. Já no Brasil permeia todo o estado do Ceará, embora não se saiba com precisão sua extensão no país. Pode evoluir de forma assintomática, aguda, comumente com sepse, até a cronificação. Mimetiza inúmeras outras doenças,que, por falta de conhecimento clínico-laboratorial, são erroneamente identificadas. Diante de sua alta morbidade e mortalidade, agravadas quando ocorrida com fatores de risco, como diabetes mellitus, principal potencializador da doença, a necessidade de uma diagnose eficientes e faz necessária, em que o tempo é o principal obstáculo, haja vista a demora de gerar-se um resultado através dos ensaios comumente utilizados. A espectrometria de massas e suas demais abordagens são ferramentas de aperfeiçoamento dos resultados, destacando-se o que se refere à sensibilidade, precisão e velocidade de análise. Essa técnica permite a identificação de milhares de proteínas, por meio da análise da expressão diferencial qualitativo-quantitativa dos perfis proteicos em diferentes amostras. Portanto, a partir desse cenário, a elaboração deste estudo se justifica pela necessidade de adicionar mais um método analítico, que melhore a diagnose laboratorial e, consequentemente, amplie as opções de investigação, que visam subsidiar o manejo clínico, na forma de um perfil proteico característico da doença, suportandomelhores abordagens para permitir o diagnóstico correto e precoce da melioidose. O estudo transversal suscitou em um perfil proteico, oriundo de uma amostra clínica de soro, confirmada para melioidose, obtida em momentos distintos do seguimento farmacoterapêutico, elucidando possível painel proteico para essa infecção, através de análise diferencial das proteínas expressas por meio da técnica de ESI-TOF/MS. Foram detectadasproteínas de fase agudo-crônicadiferencialmente expressas. Conclui-se, então, que a técnica aqui utilizada foi útil na detecção de perfil proteico de interesse para conduta clínica, visando reduzir o tempo de resposta à abordagem terapêutica. Entretanto, mais estudos são necessários, commaior número de pacientes, para investigar outras proteínas expressas, comotambém, pela perspectiva do patógeno, para que se possa expandir ainda mais o conhecimento e melhoraros bancos de dados que envolvem melioidose. Palavras-chaves: Melioidose. Biomarcadores. Espectrômetro de Massas.
- Published
- 2018
166. Ação antiobesidade da suplementação com ômega-3 em ratos wistar
- Author
-
Araujo, Silvana Macedo de, Moreira, Renato de Azevedo, Raposo, Ramon da Silva, Moreira, Ana Cristina de Oliveira Monteiro, and Queiroz, Dinalva Brito
- Subjects
Metabolismo ,Obesidade ,Ácidos graxos ômega 3 - Abstract
Made available in DSpace on 2022-06-22T23:55:17Z (GMT). No. of bitstreams: 0 Previous issue date: 2018-01-30 Obesity and Its co morbidity has become world endemic health problem. Among several triggers to this condition, evolution in diet composition with large amounts intake of energetic foods, added to limited physical activities due to the modern people habits, are notables factors. Change in ratio omega-6/omega-3 fatty acids intake is an important obesity cause and can make the co morbidity become worst. Many researches evidence the role of the fatty acids omega-6/ômega3 ratio as effective health promoter by, modulating its bio-active derivatives; the eicosanoids and cytokines. The aim of this study is to evidence the anti-obesity effect of a diet supplementation with omega-3 fatty acids, and, specific aims are following up rats corporal weight, adipocytes size and blood levels of total cholesterol, high density lipoprotein (HDL) and triglycerides. This was an experimental study with five Wistar male rats groups (n=6), with body weight upper 260g. One group was euthanized at day one; two groups received intake of water by gavage during 45 and 90 days, respectively, and two groups received intake of 0,1mg/kg/weigh/day of high purified omega-3 (EPA 350 mg/ml + DHA 220 mg/ml) for 45 and 90 days. All animals received intake of water and food at libitum during the experience. .The results showed decreasing in blood total cholesterol, and triglycerides levels (p
- Published
- 2018
167. Perfil proteômico comparativo de idosos hipertensos ativos e sedentários
- Author
-
Barroso, Mateus Lemos, Moreira, Ana Cristina de Oliveira Monteiro, Lima, Danilo Lopes Ferreira, Lobo, Marina Duarte Pinto, and Pinto, Nilson Vieira
- Subjects
Saúde pública ,Idosos - Hipertensão arterial ,Idosos - Exercícios físicos - Abstract
Made available in DSpace on 2022-06-22T23:52:11Z (GMT). No. of bitstreams: 0 Previous issue date: 2018-01-29 Introduction: Hypertension is a disease that represents a major public health problem worldwide. Physical exercise appears as a non-pharmacological therapeutic alternative for the treatment of hypertensive patients. Objective: To compare the protein profile of active and sedentary hypertensive lives. Methodology: This is a direct, transversal, descriptive, prospective and quantitative analysis. The sample consisted of 38 hypertensive years, 20 of which were active and 18 were sedentary. Data were evaluated through a series of physical and physical and physical evaluation (BMI and CC). RESULTS: Envy are the highest blood pressure levels at rest, being detected with hypertension in stages 1, 2 and 3. This group was also classified as more overweight and obese than the active ones. CC values were similar in groups with very high risk. The C4-a and IGLC1 proteins obtained higher expression in the sedentary group. HBD and FGA were characterized as down, being less expressed in sedentary individuals than in the active group. Conclusion: As proteins evidenced by the relationships with inflammation. HBD should not have undergone physical exercise. Keywords: Proteomic; Hypertension; Exercise; Aged. Introdução: A hipertensão arterial é uma doença que representa atualmente um grande problema de saúde pública mundial. O exercício físico surge como uma alternativa terapêutica não farmacológica para o tratamento de hipertensos. Objetivo: Comparar o perfil proteômico de idosos hipertensos ativos e sedentários. Metodologia: Trata-se de uma pesquisa direta, transversal, descritiva, prospectiva e com análise quantitativa. A amostra foi composta por 38 idosos hipertensos, sendo 20 ativos e 18 sedentários. Para a coleta dos dados foi realizadas uma avaliação de nível de atividade física, pressão arterial de repouso, coleta de sangue para a análise proteômica e composição corporal (IMC e CC). Resultados: Os inativos apresentaram níveis pressóricos maiores em repouso, sendo detectados com hipertensão estágios 1, 2 e 3. Este grupo também foi classificado com mais sobrepeso e obesidade do que os ativos. Os valores de CC foram semelhantes em ambos os grupos, com o risco muito aumentado. As proteínas C4-a e IGLC1 obtiveram maior expressão no grupo de sedentários. A HBD e o FGA foram caracterizadas como ¿down¿, sendo menos expressas nos sedentários do que no grupo dos ativos. Conclusão: As proteínas evidenciadas têm relações diretas com a inflamação. A HBD pode ter sido menos expressa nos sedentários devido às modificações fisiológicas promovidas pelo exercício físico. Palavras-chave: Proteômica; Hipertensão; Exercício; Idoso.
- Published
- 2018
168. Perfil proteômico de pacientes com síndrome antifosfolípide primária
- Author
-
Araújo, Débora Medeiros, Moreira, Ana Cristina de Oliveira Monteiro, Rodrigues, Carlos Ewerton Maia, Lobo, Marina Duarte Pinto, and Rabelo Júnior, Carlos Nobre
- Subjects
Síndrome antifosfolípidica ,Espectometria de massas - Abstract
Made available in DSpace on 2022-06-22T23:51:50Z (GMT). No. of bitstreams: 0 Previous issue date: 2018-01-04 The antiphospholipid syndrome (APS) is characterized by thrombotic events and gestational loss of repetition and is considered the most common acquired thrombophilia. When it is not associated with any connective tissue disease it is said to be primary APS (PAPS). Although diferente mechanisms have been proposed to explain the state of hypercoagulability in APS, such as the induction of tissue factor expression by endothelial cells and monocytes, the precise pathogenesis of the disease remains unknown. In this study, using mass spectrometry, one of the most sensitive current proteomic techniques, allowing the large-scale study of the expression, location and structure profiles of different proteins of the organism, we evaluated on the plasma a pattern expressed protein of 14 patients with PAPS when compared to 17 controls, matched for age and sex. As a result, a pattern of 11 different proteins was detected in plasma from PAPS carriers over controls. Four proteins were related to pathophysiological mechanisms involved in the development of thrombosis: alpha-chain fibrinogen, gamma-chain fibrinogen, apolipoprotein C-III and ¿-1-glycoprotein-1. These proteins are functionally related to processes primarily associated with the induction of a pro-coagulant state, as well as autoimmune responses. The use of these proteins as biomarkers, may help the management of patients with PAPS, as it¿s a useful tool to identify the risk of developing thromboembolic complications. Future prospective studies should confirm these findings using a larger number of patients with APS. Keywords: mass spectrometry; biomarkers; antiphospholipid syndrome. A síndrome antifosfolípide (SAF) é caracterizada por eventos trombóticos e perdas gestacionais de repetição e é considerada a trombofilia adquirida mais comum. Quando não está associada a alguma doença do tecido conectivo é dita como SAF primária (SAFP). Embora diferentes mecanismos tenham sido propostos para explicar o estado de hipercoagulabilidade na SAF, como a indução da expressão do fator tecidual por células endoteliais e monócitos, a fisiopatologia precisa da doença ainda não é totalmente conhecida. Nesse estudo, utilizando a espectrometria de massas, uma das técnicas proteômicas atuais mais sensíveis, que permite o estudo em grande escala dos perfis de expressão, localização e estrutura de diferentes proteínas do organismo, avaliamos o padrão de proteínas expressas no plasma de 14 pacientes portadores de SAFP comparados com o de 17 controles, pareados para idade e sexo. Como resultado, um padrão de 11 proteínas diferentes foi detectado no plasma de portadores de SAFP em relação aos controles. Quatro proteínas apresentaram relação com mecanismos fisiopatogênicos envolvidos no desenvolvimento da trombose: fibrinogênio de cadeia alfa, fibrinogênio de cadeia gama, apolipoproteína C-III e a ¿-1- glicoproteína-1. Essas proteínas estão relacionadas funcionalmente com processos principalmente associados à indução de um estado pró-coagulante, bem como respostas autoimunes. A utilização dessas proteínas como biomarcadores, pode auxiliar o manejo de pacientes com SAFP, por ser uma ferramenta útil para identificar o risco de desenvolver complicações tromboembólicas. Futuros estudos prospectivos devem confirmar esses achados utilizado um número maior de pacientes com SAFP. Palavras-chaves: espectrometria de massas; biomarcadores; síndrome antifosfolipídica.
- Published
- 2018
169. Evaluation of the antifungal activity of chitin binding lectins from Mauritia flexuosa and Artocarpus incisa in Candida albicans, Cryptococcus neoformans and Aspergillus fumigatus
- Author
-
Cavalcante, Yuri Costa Barreto, Moreira, Ana Cristina de Oliveira Monteiro, and Silva, Olga Maria Duarte
- Subjects
Ciências da Saúde ,Teses de mestrado - 2017 ,Ciências Biofarmacêuticas - Abstract
Tese de mestrado, Ciências Biofarmacêuticas, Universidade de Lisboa, Faculdade de Farmácia, 2017 Submitted by Repositório FFUL (repositorio@ff.ul.pt) on 2018-07-20T11:49:07Z No. of bitstreams: 1 TM_Yuri_Barreto.pdf: 1781088 bytes, checksum: 52218fcfc7dfdf481927068be19f20e4 (MD5) Made available in DSpace on 2018-07-20T11:49:27Z (GMT). No. of bitstreams: 1 TM_Yuri_Barreto.pdf: 1781088 bytes, checksum: 52218fcfc7dfdf481927068be19f20e4 (MD5) Previous issue date: 2017-07-27
- Published
- 2017
170. Avaliação do diagnóstico laboratorial de melioidose no Ceará
- Author
-
Lima, Leoniti Dantas Queiroz, Rolim, Dionne Bezerra, Ribeiro, Ana Karoline da Costa, and Moreira, Ana Cristina de Oliveira Monteiro
- Subjects
Melioidose ,Diagnóstico - Abstract
Made available in DSpace on 2022-06-22T23:47:04Z (GMT). No. of bitstreams: 0 Previous issue date: 2017-01-30 Melioidosis is an emerging highly lethal infectious disease caused by Burkolderia pseudomallei, whose worldwide distribution is expanding. Its detection at Brazil is underestimated, although the country is already considered endemic. Ceará presents 94% of the cases diagnosed at Brazil. Potentially mimicking and with laboratory confirmatory diagnosis, its detection is made difficult by the lack of knowledge of health professionals and adequate laboratory structure. This study analyzed the capacity diagnostic of melioidosis at the state of Ceará. The laboratory network of the city of Fortaleza was analyzed through structured questionnaires of the capacity diagnostics: identified microorganisms; specimens analyzed; transport and storage of sample; processing and identification of bacteria; waste disposal; registration and notification of data. Another stage analyzed the diagnosis of confirmed cases of the disease in the period of 2003 to 2016: general characteristics of the cases, diagnostic criteria, diagnostic method used, time of diagnosis, clinical aspects of the cases, laboratories and hospitals in the occurrence of clinical cases. The study showed that only four of the nine laboratories evaluated have identified B. pseudomallei. The VITEK 2 automated system that has bacterial detection capability is used by seven laboratories. There is no attempt to reisolate the bacteria on suspected contamination plaques in seven laboratories, which may hinder the routine identification of B. pseudomallei. Twenty nine cases of melioidosis were diagnosed between 2003 and 2015. The microbiological diagnosis was made in 86% (25) of clinical cases and 14% (4) according to clinical-epidemiological criteria. The VITEK 2 automated method was responsible for 82% (22) of the bacterial identification. Fifty two percent of the cases diagnosed in Ceará between years 2003 to 2016 occurred after death. The State of Ceará doesn¿t have adequate diagnostic capacity to detect melioidosis in laboratories. It is necessary to improve the laboratory structure and develop strategies that facility the knowledge of the disease by health professionals, especially physicians and microbiologists. Keywords: Burkholderia pseudomallei; melioidosis; diagnosis. Melioidose é uma doença infecciosa emergente e de elevada letalidade, causada pela Burkolderia pseudomallei cuja distribuição mundial encontra-se em expansão. Sua detecção no Brasil é subestimada, embora o país já seja considerado endêmico. O Ceará apresenta 94% dos casos diagnosticados no Brasil. Potencialmente mimetizadora e com diagnóstico confirmatório laboratorial, sua detecção é dificultada pela falta de conhecimentos dos profissionais de saúde e de estrutura laboratorial adequada. Esse estudo analisou a capacidade de diagnóstico da melioidose no Ceará. A rede laboratorial da cidade de Fortaleza foi analisada através de questionários estruturados sobre a capacidade de diagnóstico: microrganismos identificados; espécimes analisados; transporte e armazenamento de amostra; processamento e identificação de bactérias; descarte de cepas; registro e notificação de dados. Outra etapa analisou o diagnóstico dos casos confirmados da doença entre o período de 2003 a 2016: características gerais dos casos, critério diagnóstico, método diagnóstico utilizado, tempo do diagnóstico, aspectos clínicos dos casos, laboratórios e hospitais de ocorrência dos casos clínicos. O estudo evidenciou que somente quatro dos nove laboratórios avaliados já identificaram a B. pseudomallei. O sistema automatizado VITEK 2, que possui capacidade de detecção da bactéria, é utilizado por sete laboratórios. Não há tentativa de reisolamento de bactérias em placas suspeitas de contaminação em sete laboratórios, o que pode dificultar a identificação rotineira de B. pseudomallei. Vinte e nove casos de melioidose foram diagnosticados entre o período de 2003 e 2015. O diagnóstico microbiológico ocorreu em 86% (25) dos casos clínicos e 14% (4) por critério clínico-epidemiológico. O método automatizado VITEK 2 foi responsável por 82% (22) da identificação da bactéria. Cinquenta e dois por cento dos casos diagnosticados no Ceará, entre os anos de 2003 e 2016, ocorreram após o óbito. O Estado do Ceará não apresenta capacidade diagnóstica adequada para detectar melioidose em seus laboratórios. Há necessidade de melhorar a estrutura laboratorial e desenvolver estratégias que facilitem o conhecimento da doença pelos profissionais de saúde, especialmente médicos e microbiologistas. Palavras-chave: Burkholderia pseudomallei; melioidose; diagnóstico.
- Published
- 2017
171. Thermal characterization of polymer-based green roofs
- Author
-
Tavares Neto, Plínio de Assis, Câmara, Leôncio Diógenes Tavares, Moreira, Ana Cristina Fontes, and Aranda, Donato Alexandre Gomes
- Subjects
Método de equivalência de resistências ,Greenflex ,Caracterização térmica ,ENGENHARIAS::ENGENHARIA MECANICA::ENGENHARIA TERMICA [CNPQ] ,Controle de temperatura ,Desempenho térmico ,Telhados verdes ,Thermal performance ,Commelina ,Isolamento (Térmico) ,Propriedades térmicas ,Resistance equivalence method ,Thermal characterization - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:59Z No. of bitstreams: 1 Dissertacao_PlinioDeAssisTavaresNeto.pdf: 3554667 bytes, checksum: ab66616c96589f3ab5ccb82c5102f941 (MD5) Made available in DSpace on 2021-01-05T18:30:59Z (GMT). No. of bitstreams: 1 Dissertacao_PlinioDeAssisTavaresNeto.pdf: 3554667 bytes, checksum: ab66616c96589f3ab5ccb82c5102f941 (MD5) Previous issue date: 2016-12-16 Coordenação de Aperfeiçoamento de Pessoal de Nível Superior This work proposes a new method for thermal characterization of green roofs, which is based on the analysis of the temperature profiles, through a new approach Thermal Resistance Equivalent. Temperature measurements were performed in two modules with asbestos tiles: one with a green cover and the other with insulating material. In the new method, called Resistance Equivalent Method, layers of insulating material are used, with known thermal conductivity, in order to achieve equivalent temperature profiles for both modules, with and without green cover. Thus, it is possible to obtain the equivalent conductivity coefficient (k) of structural material with the plant. It is worth noting that the literature is lacking as to methods and / or techniques to this end. In the characterization study, the thermal coefficients of the substrates were obtained from the literature, but in the case of plants, there are few methods and / or data thermal properties of these materials. This method is basically to reach an equivalent thermal resistance of green cover with the insulating material of known thermal conductivity ranging, for this, its thickness. In the study it was possible to a flexible structural base (GreenFlex) for the construction of green roofs, which has been patented due to the novelty and originality of the new material [1]. Thermal characterization experiments were done Greenflex the material with the plant genus Commelina, it is possible to obtain equivalent thermal conductivity, specific heat and density, which are respectively equal to: 0.159 W / mK, 2.96 kJ / kgK and 875.3 kg / m³. Neste trabalho foi proposta uma nova metodologia de caracterização térmica de coberturas verdes, a qual se baseia na análise dos perfis de temperatura, através de uma nova abordagem de Resistência Térmica Equivalente. Foram realizadas medições de temperatura em dois módulos com telhas de amianto: um com cobertura verde e outro com material isolante. No novo método, chamado de Método de Resistências Equivalentes, são utilizadas camadas de material isolante, com condutividade térmica conhecida, de forma a se alcançar perfis de temperatura equivalentes para ambos os módulos, com e sem cobertura verde. Com isso, é possível obter o coeficiente de condutividade equivalente (k) do material estrutural com a planta. Vale salientar que a literatura é carente quanto a métodos e/ou técnicas com tal objetivo. No estudo de caracterização, os coeficientes térmicos dos substratos foram obtidos da literatura, porém no caso das plantas, são escassos métodos e/ou dados de propriedades térmicas destes materiais. Este método consiste, basicamente, em chegar numa equivalência da resistência térmica da cobertura verde com o material isolante de condutividade térmica conhecida variando, para isso, a sua espessura. Com o estudo foi possível chegar numa base estrutural flexível (Greenflex) para construção de telhados verdes, a qual foi patenteada devido à novidade e originalidade do novo material [1]. Foram feitos experimentos de caracterização térmica do material Greenflex, com plantas do gênero Commelina, sendo possível obter a condutividade térmica equivalente, o calor específico e a densidade, os quais são, respectivamente, iguais a: 0,159 W/mK, 2,96 kJ/kgK e 875,3 kg/m³.
- Published
- 2016
172. Análise proteômica de plasma de pacientes com infecção pulmonar associada à ventilação mecânica
- Author
-
Costa, Lucianna Auxi Teixeira Josino da, Moreira, Ana Cristina de Oliveira Monteiro, Lobo, Marina Duarte Pinto, Medeiros, Melissa Soares, and Moreno, Frederico Bruno Mendes Batista
- Subjects
Proteômica ,Respiração artificial ,Infecção hospitalar ,Pneumonia - Abstract
Made available in DSpace on 2022-06-22T23:47:14Z (GMT). No. of bitstreams: 0 Previous issue date: 2016-10-28 Although Ventilator-Associated Pneumonia (VAP) is associated with high prevalence and mortality. Risk factors added to the clinical situation help to suggest it, but not confirmed. The microbiological study improves the diagnostic accuracy and helps in the treatment, but there is not always bacterial or fungal growth. A plasm protein profile would help the diagnosis of patients with ventilator-associated pneumonia (VAP). Fifty patients were enrolled resulting in 14 with the diagnosis of VAP and 36 with Complication Ventilator-Associated Complication, VAC. Three risk factors were associated with VAP, length permanence in ICU, Parenteral Nutrition Total (PNT) and the presence of multidrug-resistant bacteria to carbapenens. Totality, eleven proteins were identified by Mass Espectrometry,ESI-TOF, five only in patients and six expressed in different ways in both groups, patients and controls. Immunoglobulin free light chain Kappa, Serum Amyloid A1 / A2, C-Reactive Protein (CRP) and Cofactor heparin II were expressed in plasms of hospitalized patients with lung infection. The six others proteins, two were down-regulated in patients compared to controls: Apolipoprotein AII and Alpha 2 HS Glycoprotein. Four proteins were up-regulated in patients: Complement C9, Alpha 1 Acid Glycoprotein, Alpha 1 Antichymotrypsin and Leucine Rich in Alpha 2 Glycoprotein. The group where the tracheal aspirate showed fungal growth did not express the protein Alpha 2 HS Glycoprotein and Cofactor heparin 2. Furthermore, Leucine Rich in Alpha 2 Glycoprotein was higher in the group of fungi than the others, with ratio of 5.75. This is the first Brazilian research, as our knowledge, by analyzing proteomic techniques plasm of patients with ventilator-associated infection. Keywords: Proteomics analysis, VAP, ESI-TOF, Leucin Rich Alpha 2 Glycoprotein, Fungal disease. Pneumonia associada à ventilação mecânica (PAV) tem altas prevalência e mortalidade. Fatores de risco somados aos os dados clínicos ajudam a sugeri-la, porém não a confirmam. O estudo microbiológico aumenta a acurácia diagnóstica e contribui no tratamento, porém nem sempre há crescimento bacteriano ou fúngico. Um perfil proteico plasmático auxiliaria no diagnóstico dos pacientes com infecção associada à ventilação mecânica. Cinquenta pacientes foram seguidos resultando em 14 com o diagnóstico de PAV e 36 com Complicação Associada à Ventilação Mecânica, CAV. Três fatores de risco estavam associados com PAV, tempo de permanência aumentada em UTI, uso de Nutrição Parenteral Total (NPT) e presença de bactéria multirresistente aos Carbapenêmicos. Onze proteínas foram diferencialmente expressas por ESI-TOF, sendo cinco unicamente nos doentes e seis sendo expressas de maneiras diferentes nos dois grupos, doentes e sadios. Imunoglobulina de cadeia leve Kappa, Amiloide sérica A1/A2, Proteína C Reativa (PCR) e Cofator de Heparina 2 estavam expressas nos plasmas dos pacientes internados com infecção pulmonar. Das seis proteínas restantes, duas estavam down-regulated nos pacientes em relação aos controles: Apolipoproteína AII e Alfa 2 HS Glicoprotéina.Quatro proteínas estavam up-regulated nos doentes: Complemento C9,Alfa 1 Glicoproteína Ácida, Alfa 1 Antiquimiotripsina e Leucina Rica em Alfa 2 Glicoproteína. O grupo onde o aspirado traqueal mostrou crescimento fúngico não expressou as proteínas Alfa 2HS Glicoproteína e Cofator de Heparina 2. Glicoproteína alfa 2 rica em Leucina foi superior no grupo com fungos em relação aos demais, com razão de 5,75. Este é o primeiro trabalho brasileiro, até onde se tem conhecimento, que analisa por técnicas de proteômica (ESI-TOF), o plasma de pacientes com infecção pulmonar associada à ventilação mecânica. Palavras-chave: Análise proteômica, PAV, ESI-TOF, Glicoproteína Alfa 2 rica em Leucina, doença fúngica.
- Published
- 2016
173. Perfil bioquímico, celular e proteômico do plasma de pacientes com câncer de cabeça e pescoço submetidos a terapia nutricional enteral imunomoduladora no pós-cirúrgico
- Author
-
Santos, Semiramis Silva, Moreira, Ana Cristina de Oliveira Monteiro, Lobo, Marina Duarte Pinto, Furtado, Gilvan Pessoa, and Matos, Maria Rosimar Teixeira
- Subjects
Pescoço - Câncer ,Nutrição enteral ,Cabeça - Câncer - Abstract
Made available in DSpace on 2022-06-22T23:47:29Z (GMT). No. of bitstreams: 0 Previous issue date: 2016-08-12 The head and neck cancer is considered one of the main tumors affecting people in Brazil and around the world. Nutritional deficiencies, favored by catabolic factors secreted by the tumor itself, result in immune deficiencies that compromise the patient's prognosis. enteral nutritional therapy immunomodulatory has shown clinical benefit in the treatment of head and neck cancer because it can favorably modulate the immune and inflammatory response. The aim of the study was to characterize the biochemical profile, cellular and proteomic of patients with head and neck cancer undergoing enteral nutritional therapy immunomodulatory postoperatively. The evaluations were performed in patients admitted to the Hospital Haroldo Juaçaba - Ceará Cancer Institute, where immunomodulation occurred for a period of 3 to 5 days. The sample was mostly male, malnourished and elderly. Plasma proteins were quantified and subjected to electrophoresis, affinity chromatography depletion of albumin and IgG, identification and quantification by mass spectrometry. The results showed that before use of immunomodulatory diet amyloid protein A1 and serum A2 and C-reactive protein, positive acute phase proteins in the inflammatory process, had levels of increased expression in the plasma of patients, and after the use of immunomodulatory diet B factor of the complement system. We also identified six proteins that are used as tumor markers: serum amyloid A, plasmin, Zinc alpha 2-glycoprotein, alpha 1 antichymotrypsin, alpha 2-glycoprotein rich in leucine 1 and 2, and heavy chain immunoglobulin M. It is concluded that protein with a higher level of expression in response to the use of enteral nutritional therapy immunomodulatory postoperatively was the B factor of the complement system. Key words: Immunonutrition; head and neck cancer; proteomics. O câncer de cabeça e pescoço é considerado um dos principais tumores que acometem as pessoas no Brasil e no mundo. As deficiências nutricionais, favorecida por fatores catabólicos secretados pelo próprio tumor, resultam em deficiências imunológicas que comprometem o prognóstico do paciente. Terapia nutricional enteral imunomoduladora tem mostrado benefício clínico no tratamento do câncer de cabeça e pescoço, pois pode modular favoravelmente a resposta imunitária e inflamatória. O objetivo do estudo foi caracterizar o perfil bioquímico, celular e proteômico de pacientes com câncer de cabeça e pescoço submetidos a terapia nutricional enteral imunomoduladora no pós-operatório. As avaliações foram realizadas em pacientes internados no Hospital Haroldo Juaçaba - Instituto do Câncer do Ceará, onde a imunomodulação ocorreu pelo período de 3 a 5 dias. A amostra foi na sua maioria do gênero masculino, desnutridos e idosos. As proteínas plasmáticas foram quantificadas e submetidas a eletroforese, cromatografia de afinidade para depleção de albumina e IgG, identificação e quantificação por espectrometria de massas. Os resultados obtidos mostraram que antes do uso da dieta imunomoduladora as proteínas amilóide A1 e A2 sérica e proteína C reativa, proteínas de fase aguda positivas no processo inflamatório, apresentaram nível de expressão aumentado no plasma dos pacientes e, após o uso de dieta imunomoduladora, o fator B do sistema complemento. Também foram identificadas seis proteínas que são utilizadas como marcadores tumorais: amilóide A sérica, plasmina, zinco alfa 2-glicoproteína, alfa 1 antiquimiotripsina, alfa 2-glicoproteína rica em leucina 1 e 2 e cadeia pesada de imunoglobulina M. Concluiu-se que a proteína com maior nível de expressão em resposta ao uso de terapia nutricional enteral imunomoduladora no pós-operatório foi o fator B do sistema complemento. Palavras chaves: Imunonutrição; câncer cabeça e pescoço; proteômica.
- Published
- 2016
174. Chemical modifications of the high molecular weight polyethylene for applications in biomaterials
- Author
-
Raposo, Matheus Pinheiro, Rocha, Marisa Cristina Guimarães, Moreira, Ana Cristina Fontes, Silva, Antonio Henrique Monteiro da Fonseca Thomé da, Nunes, Regina Celia Reis, and Silva, Ana Lúcia Nazareth da
- Subjects
Polímeros ,Tribology ,Radiação gama ,Radiação ,Arscobic acid ,ATocoferol ,Tocoferol ,High molecular weight polyethylene ,Resistência dos materiais ,Tribologia ,Gamma radiation ,Polietileno Propriedades mecânicas ,Ácido ascórbico ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA [CNPQ] - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:48Z No. of bitstreams: 1 Dissertacao_MatheusPinheiroRaposo.pdf: 5466502 bytes, checksum: cd419fa87da7f67115dc2d26d9d9d1e3 (MD5) Made available in DSpace on 2021-01-05T18:30:48Z (GMT). No. of bitstreams: 1 Dissertacao_MatheusPinheiroRaposo.pdf: 5466502 bytes, checksum: cd419fa87da7f67115dc2d26d9d9d1e3 (MD5) Previous issue date: 2016-03-11 The high molecular weight polyethylene (PEAPM) is a polymer having desirable characteristics such as: good mechanical properties, low coefficient of friction and selflubricating surface. This combination of properties confers use as orthopedic prostheses, however, when compared to metals their properties are still inferior making it necessary to increase mainly its tensile strength. The most processes can be used for this purpose, this study will be evaluated using gamma radiation to increase the tensile strength of polyethylene. Also reported is the effect of addition of ascorbic acid (vitamin C) and tocopherol (vitamin E) in mechanical and tribological properties of the polyethylene. To achieve this goal we used a planning of factorial experiments 2 ^ 3, with the following input variables: concentration of vitamin E, vitamin C concentration and radiation dose. response variables analyzed were obtained by the following techniques: Gel content testing, dynamic mechanical analysis (DMA - crosslink density), analysis of infrared spectroscopy (FTIR - oxidation index and crosslinking index), tensile test ( modulus, maximum stress, yield stress) analysis tribological (friction coefficient, maximum depth). Schedules demonstrated that PEAPM with addition of 3% vitamin E and radiation dose of 100 kGy showed better tribological, chemical and mechanical properties for use as a biomaterial polymer. O polietileno de alto peso molecular (PEAPM) é um polímero que apresenta características desejáveis como: boas propriedades mecânicas, baixo coeficiente de fricção e superfície auto lubrificante. Esse conjunto de propriedades lhe confere utilizações como próteses ortopédicas, entretanto, quando comparado aos metais suas propriedades ainda são inferiores tornando-se necessário elevar, principalmente, sua resistência à tração. Vários processos podem ser utilizados para esta finalidade, neste trabalho será avaliado a utilização de radiação gama para elevar a resistência à tração do polietileno. Além disso será avaliado o efeito de adição de ácido ascórbico (vitamina C) e de tocoferol (vitamina E) nas propriedades mecânicas e tribológicas deste polietileno. Para alcançar esse objetivo foi utilizado um planejamento de experimentos do tipo fatorial 23, com as seguintes variáveis de entrada: concentração de vitamina E, concentração de vitamina C e dose de radiação. As variáveis de resposta analisadas foram obtidas pelas seguintes técnicas: ensaio de teor de gel, análise dinâmico-mecânica (DMA - densidade de reticulação), análise de espectroscopia de infravermelho (FTIR - índice de oxidação e índice de reticulação), ensaio de tração (módulo de elasticidade, tensão máxima, tensão de escoamento), análise tribológica (coeficiente de atrito, profundidade máxima). Os planejamentos demonstraram que o PEAPM com adição de 3% de vitamina E e dose de radiação de 100 kGy apresentou melhores propriedades tribológicas, químicas e mecânicas para utilização do polímero como biomaterial.
- Published
- 2016
175. Plasma proteomic analysis of patients with mielodisplasic síndrome type arsa and areb, using vegetal lectins
- Author
-
Romero, José Camilo Torres, Moreira, Renato de Azevedo, and Moreira, Ana Cristina de Oliveira Monteiro
- Subjects
Proteômica ,Biomarcador ,AREB ,Lectina ,ARSA ,Síndromes Mielodisplásicas - Abstract
ROMERO, José Camilo Torres. Análise proteômica do plasma de pacientes portadores de síndrome mielodisplásica do tipo areb e arsa utilizando lectinas vegetais. 2016. 104 f. Tese (Doutorado em Bioquímica)-Universidade Federal do Ceará, Fortaleza, 2016. The myelodysplastic syndromes (Myelodysplastic Syndrome MDS) are diseases that occur when blood-producing cells are damaged bone marrow. This causes damage to one or moretypes of blood cells because its production is defective. MDS is considered a type of cancer and often end up being melodie acute leukemia (AML). The most common types of these syndromes are refractory anemia with ringed sideroblasts (ARSA) and anemia refractory with Excess Blasts (AREB). This study aimed to carry out the proteomic analysis of spinal cord serum of pediatric patients with any of the syndromes for the identification of proteins that are potential candidates for biological markers for evaluation, study and diagnosis of disease. The samples from ten patients with ARSA, tem with AREB and Ten healthy persons (control) were compared. These were subjected to immunodepletion, affinity chromatography with lectin galactose-linker selected by the anomeric recognition profile using chromatography in crosslinked hemicelulases, the selected lectins were subsequently immobilized in Sepharose 4B, the serum bone marrow samples were digested for subsequent analysis by mass spectrometry. The softwareExpressionE, based on protein expression levels, calculated the ratio between the selected groups, so 7 proteins have been identified as possible candidates for the biomarker syndromes. The overexpression of Vitronectin (VTN), fibrinogen (FGA), Pregnancy zone protein (PZP), Kininogen (KNG1) Immunoglobulin lambda chain (IGL), complement factor C4b (CB4) and Hemopexin (HPX) compared with the group control, seems to be an indicator of syndromes and were selected to form a panel of potential candidates for prognostic biomarkers. The only recognition by the frutalin to Clusterin (CLU) and Vitronectin in ARSA and Fibrinogen to AREB, do lectin a very useful tool to differentiate syndromes in proteomics studios. As Síndromes Mielodisplásicas (SMD) são doenças que ocorrem quando as células produtoras de sangue são danificadas na medula óssea e esses danos podem afetar um ou mais tipos de células sanguíneas. Os tipos mais comuns de SMD são a Anemia Refratariacom Sideroblastos em Anel (ARSA) e Anemia Refratariacom Excesso de Blastos (AREB). Este trabalho teve como objetivo realizar a análise proteômica do plasmamedular de pacientes com SMD tipo ARSA e AREB, visando àidentificação de proteínas que sejam potenciais candidatas a marcadores biológicos para avaliação, estudo e diagnóstico dessas doenças. Amostras de plasmade dez pacientes com ARSA, dez com AREB e dez indivíduos saudáveis (Controle) foram selecionadas para análise proteômica. Estas foram submetidas à imunodepleção, cromatografia de afinidade com lectina α-D-galactose-ligante de sementes de Artocarpus incisa imobilizada em SepharoseTM 4B, concentradas e digeridas para posterior análise por espectrometria de massas. O programa ExpressionE, baseado nos níveis de expressão das proteínas, calculou a razão entre os grupos selecionados. Foram identificadas 7 proteínas potenciais candidatas a biomarcadores, tais como a Vitronectina (VTN), Fibrinogênio (FGA), Pregnancy zone protein (PZP), Cininogênio (KNG1), Cadeia de Imunoglobulina Lambda (IGLL1), Factor do complemento Cb4 (Cb4) e Hemopexina (HPX), por estarem super expressas no grupo de pacientes com SMD, em ambos os tipos, ao se comparar com o grupo controle (indivíduos sadios). Estas foram selecionadas para formar um painel de proteínas candidatas biomarcadoresde diagnóstico da SMD. O reconhecimento único por parte da frutalina para Clusterina (CLU) e Vitronectina em ARSA e Fibrinogenio para AREB, torna essa lectina, uma ferramenta muito útil para diferenciar as SMD em estudos proteômicos.
- Published
- 2016
176. Tribological analysis in carbon steel SAE 1020 and polyamide11 interface in automotive sliding systems
- Author
-
Springer, Victor Guilherme Amaral, Bastos, Ivan Napoleão, Moreira, Ana Cristina Fontes, Aliaga, Luis César Rodríguez, and Fonseca, Maria da Penha Cindra
- Subjects
Wear Mechanisms ,Corrosão e anticorrosivos ,Tribology ,Aço carbono SAE 1020 ,Tribocorrosion ,Aço Corrosão ,Poliamida 11 ,Carbon Steel SAE 1020 ,Tribologia ,Desgaste mecânico ,Tribocorrosão ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA::METALURGIA FISICA::CORROSAO [CNPQ] ,Wear ,Mecanismos de desgaste ,Polyamide 11 - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:44Z No. of bitstreams: 1 Dissertacao_VictorGuilhermeAmaralSpringer.pdf: 3130650 bytes, checksum: 6e389c129eaefc67ef29944d570fae10 (MD5) Made available in DSpace on 2021-01-05T18:30:44Z (GMT). No. of bitstreams: 1 Dissertacao_VictorGuilhermeAmaralSpringer.pdf: 3130650 bytes, checksum: 6e389c129eaefc67ef29944d570fae10 (MD5) Previous issue date: 2015-10-05 Sliding systems with interface formed by low alloy steels and various polymers are widely used in the automotive industry in torque transmission systems subjected to axial loading. Usually these systems are coupled to steering systems and interact almost directly with the final user of the vehicle. To know the most severe wear conditions which these systems are submitted and attempt to overcome them, the tribological analysis was proposed on tribometer of the pin-on-disk type, on an interface formed by SAE 1020 steel with polyamide 11 in distilled water, 5 wt% aqueous solution of sodium chloride and 184,21 g/l natural sand aqueous solution in accordance with the automotive technical standards VW PV1210: 2010-02 and VW PV2982: 2013-07. The tests were performed at frequencies of 3.0 Hz and 1.5 Hz with a fixed amount of rotation of 10,000 cycles. The corrosion potential on open circuit was monitored throughout the test and the wear rate was calculated. It was highlighted higher friction coefficients, higher wear rates and higher corrosion potential amplitudes in samples assayed in sand solution; with milder values for the samples tested in distilled water and intermediate values for samples tested with sodium chloride solution. Sistemas deslizantes com interface formada com aços baixa liga e polímeros variados são vastamente utilizados na indústria automotiva em sistemas de transmissão de torque submetidas à carregamento axial. Geralmente esses sistemas são acoplados aos sistemas de direção e interagem quase diretamente com o usuário final do veículo. Para conhecer as condições de desgaste mais severas as quais esses sistemas são submetidos e tentar minimiza-las, foi proposta a análise tribológica, em tribômetro do tipo pino-no-disco, da interface aço SAE 1020 com poliamida 11 em água destilada, solução aquosa com 5% em massa de cloreto de sódio e solução aquosa com 184,21 g/l. de areia natural, de acordo com as normas técnicas automotivas VW PV1210:2010-02 e VW PV2982:2013-07. Os ensaios foram realizados em frequências de 3,0 Hz e 1,5 Hz com quantidade fixada em 10.000 ciclos de rotação. O potencial de corrosão em circuito aberto foi monitorado ao longo dos ensaios e a taxa de desgaste foi calculada. Foram evidenciados maiores coeficientes de atrito, maiores taxas de desgaste e maiores amplitudes de potencial de corrosão nas amostras ensaiadas em solução de areia; com valores mais brandos para as amostras ensaiadas em água destilada e valores intermediários para as amostras ensaiadas em solução de cloreto de sódio.
- Published
- 2015
177. Principal component analysis applied to electrochemical noise
- Author
-
Lisboa, Tadeu Aguiar, Bastos, Ivan Napoleão, Fabbri, Ricardo, Moreira, Ana Cristina Fontes, and Lopes, Francisco Jose Pereira
- Subjects
Amperimetria de resistência nula ,Aço - Modelos matemáticos ,Analise condutimetrica ,Electrochemical noise ,Principal components analysis ,Aço Corrosão ,Aço - Métodos estatísticos ,Ruído eletroquímico ,Analise de componentes principais ,Zero resistance ammeter ,Analise eletroquímica ,Corrosão eletrolítica ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA [CNPQ] - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:42Z No. of bitstreams: 1 Dissertacao_TadeuAguiarLisboa.pdf: 2806022 bytes, checksum: 387457dca6866f16db4cc6369dc91330 (MD5) Made available in DSpace on 2021-01-05T18:30:42Z (GMT). No. of bitstreams: 1 Dissertacao_TadeuAguiarLisboa.pdf: 2806022 bytes, checksum: 387457dca6866f16db4cc6369dc91330 (MD5) Previous issue date: 2015-03-02 In this study, a mathematical method was used to classify potential and current records of electrochemical noise tests in zero resistance ammeter (ZRA) configuration. The statistical method of multiple simple variables called Principal Components Analysis (PCA) was applied to identify patterns in these electrochemical noise data. The carbon steel UNS G10200, the austenitic stainless steels UNS S31600 and the super duplex UNS S32750 were tested in the solutions of sulfuric acid (5% H2SO4), ferric chloride (0.1 mol/L FeCl3) and sodium hydroxide (0.1% NaOH). The tests were replicated with eight repetitions to obtain reproducibility of the relatedstatistical aspects. The results showed that the principal components analysis could be used as a tool to analyze electrochemical noise signals, identifying behavior clusters of potential-time, current-time and also identifying the outliers in time domain. Neste trabalho foi utilizado um método matemático para classificar registros de potencial e corrente de ensaios de corrosão na técnica de amperimetria de resistência nula (ZRA). Foi aplicado o método estatístico de múltiplas variáveis simples chamado Análise dos Componentes Principais (PCA), cujo objetivo principal foi identificar padrões nestes dados de ruído eletroquímico. Foram testados o aço carbono UNS G10200, os aços inoxidáveis austenítico UNS S31600 e o superduplex UNS S32750 em meios de ácido sulfúrico (5% H2SO4), cloreto férrico (0,1 mol/L FeCl3) e hidróxido de sódio (0,1% NaOH). Os ensaios foram replicados com oito repetições para se ter reprodutibilidade e conhecimento dos aspectos estatísticos envolvidos. Os resultados mostraram que a análise de componentes principais pode ser utilizada como uma ferramenta para analisar sinais de ruído eletroquímico, identificando os clusters dos comportamentos potencial-tempo, corrente-tempo e acessoriamente identificar os outliers dos registros temporais.
- Published
- 2015
178. Characterization and development of clays for application in polymer nanocomposite
- Author
-
Acevedo, Nancy Isabel Alvarez, Rocha, Marisa Cristina Guimarães, Moreira, Ana Cristina Fontes, and Pacheco, élen Beatriz Acordi Vasquez
- Subjects
Polymeric nanocomposites ,Organofilização ,Characterizations ,Compósitos poliméricos ,Argila ,Homoionization ,Bacia de Taubaté ,Ilita-esmectita ,ENGENHARIAS::ENGENHARIA DE MATERIAIS E METALURGICA::MATERIAIS NAO METALICOS [CNPQ] ,Organophilization ,Taubaté basin ,Materiais nanoestruturados ,Homoionização ,Caracterização ,Illite-smectite ,Clays ,Polímeros - Misturas ,Nanocompósitos poliméricos - Abstract
Submitted by Boris Flegr (boris@uerj.br) on 2021-01-05T18:30:30Z No. of bitstreams: 1 Dissertacao_NancyIsabelAlvrezAcevedo.pdf: 3025302 bytes, checksum: 7e2fda46987b58c84bf68c599d912b49 (MD5) Made available in DSpace on 2021-01-05T18:30:30Z (GMT). No. of bitstreams: 1 Dissertacao_NancyIsabelAlvrezAcevedo.pdf: 3025302 bytes, checksum: 7e2fda46987b58c84bf68c599d912b49 (MD5) Previous issue date: 2014-03-18 Brazil is a producer of clay and has large reserves of this natural resource. However, most of its production is sold dried and milled." The development of clays for use as reinforcement in polymer nanocomposites is an option for these raw material producers, who would thus have a product with higher added value . This study aims to evaluate the potential use as nanofiller of two national clays from Taubaté basin, São Paulo, called ALIGRA and SANTA FE. In this experiment, the fractions of particles with average size of less than 0.02 obtained through wet sieving were used. The characterization studies involving granulometric, chemical, mineralogical, morphological, thermal and textural analysis, revealed very similar characteristics in both the clays. Clay fraction (< 2μm) is higher 70%. Chemical composition as the definition of clay and its components show intermediate values between those present by bentonite and kaolinitic clays used here for purposes of comparison. It should be underlined good adsorptive properties. Specific surface area BET (aBET) around of 120 m2/g, this value is higher than showed by many bentonites (74.5 m2/g). They are predominantly mesoporous, the pores predominantly in slit-shape in accordance to the characteristic layered structure of the clays. Low cationic exchange capacities (CEC), 12 meq/100 g. XRD results for samples saturated with ethylene glycol and heated revealed the predominance of illite/smectite, kaolinite and quartz in ALIGRA clay, and illite, kaolinite and quartz in the clay SANTA FE. Work continued with the clay ALIGRA the preparation of organoclay. The organoclay was obtained by ion exchange with the quaternary ammonium salt: cetril trimethyl ammonium chloride, after homogenized in sodium with sodium chloride. FTIR and TGA analyzes indicated that there was integration of organic cations Preliminary tests were performed by preparing mixtures of clays with a polypropylene matrix, and using polypropylene grafted with maleic anhydride as a compatibilizer. Results of tensile tests made in the polypropilene- purified clay compositions have reported some improvements in some tested properties. With polipropilene-organofilized compositions only improved elongation on break. More detailed studies are which would be required. O Brasil é produtor de argilas e conta com grandes reservas deste recurso natural. Porém, grande parte da sua produção é comercializada seca e moída . O desenvolvimento de argilas para seu uso como reforço em nanocompósitos poliméricos constitui uma opção para os produtores desta matéria prima que teriam assim um produto com maior valor agregado. Este trabalho visa avaliar o potencial uso como nanocarga de duas argilas nacionais provenientes da Bacia de Taubaté, São Paulo, denominadas ALIGRA e SANTA FÉ. As frações de tamanho de partícula médio menor de 0,02 mm, obtidas por peneiramento á úmido da argila homogeneizada e seca, foram utilizadas no desenvolvimento do trabalho experimental. Os estudos de caracterização, envolvendo análise granulométrica, química, mineralógica, morfológica, térmica e textural, revelaram características muito semelhantes em ambas às argilas. Fração argila, maior de 70% em massa. Composição química conforme a definição química de uma argila e os teores de seus componentes mostram valores intermédios entre as apresentadas pelas bentonitas e argila caulinítica usadas com fins de comparação. Ressaltamse boas propriedades adsorventes. Área superficial específica BET ao redor de 120 m2/g, valor maior do que o apresentado por muitas bentonitas naturais (74,5 m2/g). Predominantemente mesoporosas, com poros, maiormente em forma de fenda, característicos da estrutura em camadas das argilas. Baixa capacidade de troca catiônica, 12 meq/100g. Difratogramas de raios-X revelaram a predominância do estratificado ilita/esmectita, caulinita e quartzo na argila ALIGRA, e de ilita, caulinita e quartzo na argila SANTA FÉ. Prosseguiu-se com a argila ALIGRA a preparação da argila organofílica. A argila organofílica foi obtida por troca catiônica com o sal quaternário de amônio: cloro cetril trimetil amônio, depois de homogeneizada em sódio com cloreto de sódio. Análises FTIR e TGA indicaram que houve inserção dos cátions orgânicos. Testes preliminares foram feitas, preparando misturas das argilas com matriz de polipropileno e usando como agente compatibilizante polipropileno enxertado com anidrido maleico. Resultados de ensaios de tração reportam algumas melhoras nas propriedades testadas com as composições preparadas com as argilas purificadas. Com as composições com argilas organofílicas somente foi melhorado o alongamento na rotura. Estudos ais aprofundados são recomendados.
- Published
- 2014
179. Physicochemical properties of plant hemicelluloses
- Author
-
Sousa, Felipe Domingos de, Moreira, Renato de Azevedo, and Moreira, Ana Cristina de Oliveira Monteiro
- Subjects
Bioquímica ,Viscosidade ,Reologia - Abstract
SOUSA, F. D. Propriedades físico-químicas de hemiceluloses vegetais. 2014. 60 f. Dissertação (Mestrado em Bioquímica) - Centro de Ciências, Universidade Federal do Ceará, Fortaleza, 2014. In this work six galactomannans (Adenanthera pavonina, Caesalpinia pulcherrima, Delonix regia, Dimorphera mollis, Prosopis glandulosa, Schizolobium parahyba) and three xyloglucans (Hymenaea courbaril, Mucuna sloanei e Tamarindus indica) were isolated from seed endosperm and cotyledon, respectively, by aqueous extraction followed by precipitation with ethanol. Yield of extraction, monosaccharide ratio, macromolecular parameters as well as molar mass distribution were determined and compared to guar gum (Cyamopsis tetragonoloba), LBG (Ceratonia siliqua) and xanthan (Xanthomonas campestris). Extraction yield in relation to seed mass ranged from 7.0 to 40.63%, with xyloglucan yields higher than the galactomannans ones. Schizolobium parahyba and Caesalpinia pulcherrima galactomannans presented the lowest protein content of 0.05% e 0.08%, respectively. The Mw values ranged from 0.09 – 3.37 x107 g mol-1 Flow curves of hemicelluloses solutions at 1% (w:v) were measured by varying the shear rate from 0.1 to 100 s-1. The resulting data were fit to the Power law e Herschel-Bulkley models. All the hemicelluloses presented shear-thinning behavior. Galactomannan and xyloglucans with different monosaccharide ratio showed similar consistency index; it may be influenced of the galactose distribution pattern on the chains and the interactions among the polysaccharides molecules. Rheological properties were compared and the results suggest new hemicelluloses sources which offer more profound applications in areas such as materials science, medicine e biology. As hemiceluloses são polissacarídeos presentes na parede celular de vegetais, onde funcionam como polissacarídeos de reserva e possuem uma cadeia principal composta por ligações β-(1→4) em configuração equatorial. Neste trabalho, hemiceluloses de sementes foram avaliadas quanto as suas propriedades reológicas. Como resultado, galactomananas endospérmicas de Adenanthera pavonina, Caesalpinia pulcherrima, Delonix regia, Dimorphera mollis, Prosopis glandulosa e Schizolobium parahyba e xiloglucanas cotiledonárias de Hymenaea courbaril, Mucuna sloanei e Tamarindus indica foram isoladas por extração aquosa, seguida por precipitação em etanol. O rendimento das extrações, razão monossacarídica, parâmetros macromoleculares, assim como distribuição de massa molar foram determinados e comparados às já comercializadas goma guar (Cyamopsis tetragonoloba), LBG (Ceratonia siliqua) e goma xantana (Xanthomonas campestris). O rendimento das extrações em relação à massa das sementes mostrou um intervalo de 7,0 a 40,63%, com os maiores valores para as xiloglucanas. Galactomananas de Schizolobium parahyba e Caesalpinia pulcherrima apresentaram os menores percentuais de proteínas, 0,05% e 0,08%, respectivamente. Valores de Mw variaram dentro de um intervalo entre 0,09 – 3,37 x107 g mol-1. Curvas de fluxo das soluções de hemiceluloses a 1% (m:v) foram obtidas pela variação da taxa de cisalhamento entre 0,1 a 100 s-1. Os dados obtidos foram analisados pelos modelos de Lei das Potências e Hershel-Bulkley demonstrando caráter pseudoplástico para todas as hemiceluloses estudadas nessa concentração. Galactomananas e xiloglucanas com diferentes razões monossacarídicas apresentaram índice de consistência similar, provavelmente influenciado pelo padrão de distribuição de galactose nas cadeias e as interações entre as moléculas desses polissacarídeos. As propriedades reológicas foram comparadas e os resultados sugerem novas fontes de hemiceluloses que permitem mais aplicações em áreas como ciência dos materiais, medicina e biologia.
- Published
- 2014
180. Influência de ramificações longas nas propriedades de filmes de polietileno linear de baixa densidade
- Author
-
Dartora, Paula Cristina, Santana, Ruth Marlene Campomanes, and Moreira, Ana Cristina Fontes
- Subjects
Polietileno linear de baixa densidade ,Filmes finos ,Ensaios de materiais - Abstract
Os polímeros termoplásticos têm dominado a indústria de embalagens de vida útil curta. Dentre os principais materiais utilizados, está o polietileno linear de baixa densidade (PELBD) para a produção de embalagens flexíveis. Filmes poliméricos para embalagens necessitam de certas características, dentre elas: baixa opacidade, boa resistência ao rasgo e ao impacto e fácil processamento. Como as propriedades dos polímeros são intimamente dependentes da sua estrutura, correlações estrutura-propriedade são análises extremamente complexas, em especial quando a variável de estudo é a ramificação longa, uma vez que as técnicas de identificação e quantificação da ramificação longa estão continuamente em desenvolvimento. Nesse sentido, o objetivo desta pesquisa foi avaliar o efeito de ramificações longas, presentes no PELBD, nas propriedades de filmes flexíveis. Dessa forma, foram escolhidas duas resinas de PELBD, ambas produzidas com catalisador metalocênico (mPELBD) e comonômero hexeno, uma com e outra sem ramificações longas em sua estrutura. As resinas foram caracterizadas quanto a sua cinética de cristalização, teor de comonômero, presença de ramificações longas, comportamento reológico, distribuição de peso molecular, microscopia ótica com hot stage, fracionamento por cristalização e produtividade máxima durante a extrusão dos filmes. Também foi avaliado o efeito da ramificação longa em função do estiramento do filme, através da produção de filmes tubulares por extrusão com diferentes espessuras: 35, 60 e 100 μm. Nos filmes produzidos foram realizadas análises de propriedades óticas, mecânicas e o grau de orientação. Observou-se que a presença de ramificações longas proporciona uma cinética de cristalização mais lenta, um comportamento mais elástico. e um aumento de produtividade no processamento. Quanto às propriedades dos filmes flexíveis, as ramificações longas geraram uma melhora nas propriedades óticas, entretanto, prejudicaram as propriedades mecânicas, possivelmente por um tensionamento residual causado pela orientação preferencial dos filmes. Portanto maiores espessuras são indicadas para filmes com maior resistência mecânica. Thermoplastic polymers have dominated the short shelf-life packaging industry. Among the most used materials is Linear Low Density Polyethylene (LLDPE), employed in flexible packaging production. Polymer films for packaging should possess certain crucial properties, such as: low haze, high tear and impact resistance and easy processing. Since the properties of polymers are strongly dependent on their structure, correlations between properties and chemical structure are highly complex analyses, especially when the studied variable is long chain branching (LCB), since identification and quantification techniques of LCB are continually in development. In this sense, the aim of this work is to evaluate the effect of LCB, present on LLDPE, on properties of flexible film. This way, two LLDPE grades were chosen, both produced with a metallocene catalyst (mLLDPE) and hexane comonomer. Resins were evaluated regarding their crystallization kinetics, comonomer content, long chain branches presence, rheological behavior, molecular weight distribution, optical microscopy with hot stage, crystallization fractionation and maximal output rate during film production of both grades used. The effect of LCB as a function of stretch ratio was also evaluated through the production of blown films with different thicknesses: 35, 60 and 100 μm. Optical, mechanical and orientation properties were measured for each film. It was observed that LCB provides slower crystallization kinetics, a more elastic behavior and increases productivity during processing. Regarding film properties, LCB improved optical properties, but, on the other hand, decreased mechanical properties, probably due to residual tensions caused by the preferential orientation of the films. Thus, thicker films are indicated for films with higher mechanical resistance.
- Published
- 2014
181. Glycoproteins serum binding lectin high Dioclea in the study of prostate diseases
- Author
-
Bezerra, Leonardo Primo, Moreira, Renato de Azevedo, and Moreira, Ana Cristina de Oliveira Monteiro
- Subjects
Bioquímica ,Proteômica ,Prostate cancer ,Mass spectrometry ,Câncer de próstata ,Espectrometria de massas ,Lectina ,Proteomic ,Lectin - Abstract
Nowadays there are an increase number of studies based on the change of glycoproteomics profiles in several diseases, especially in the search for serum biomarkers for cancer. The direct identification and quantification of serum glycoprotein of low abundance are difficult, because proteins very abundance in the blood can difficult the identification. Thus, fractionation tools are necessary to isolate efficiently changed protein glycoforms on the blood proteome. Given the specific and reversible interaction of lectins to glycoconjugates, the use of immobilized lectins on chromatographic matrix has been frequent in order to fractionate complex mixtures, involving glycoprotein for analysis for mass spectrometry. In this context, the goal of this work was to investigate the use of binding glucose/ mannose lectin from Dioclea altíssima seed (DaL) immobilized on Sepharose chromatography matrix 4B® (DaL-Sepharose), on the fractionation of serum glycoproteins and research of potential biomarkers for prostate cancer (PC). Glycoproteins from the retained fraction obtained by chromatography of blood serum on DaL-Sepharose matrix were identified and quantified by mass spectrometry and it was obtained the protein profile to the three groups: control, benign prostatic hyperplasia and PC. The identification of differentially expressed proteins between the groups showed 132 glycoproteins, in which 29 were only identified on the group with prostate cancer or showed one reason of ln greater than 1.2 when compared to quantification on control group. After an analysis, considering the confiability of the identification, estimated by score, and the evidences on the literature that justified a possible involvement of the protein on prostate cancer, stood out: alpha-1-acid glycoprotein, thrombospondin-5 complement C4 A, haptoglobin, pregnancy zone protein, isoform 3 of alpha 1-antitrypsin, alpha-2 glycoprotein rich in leucine and Zinc finger protein. The analysis of fractionated bood serum by DaL-Sepharose matrix with prior depletion of Human Serum Albumin and IgG allowed the identification of alpha 1-antitrypsin and the IGK protein “only” on the group with CaP and the pregnancy zone protein and protein like alfa-1 mieloma up regulated on CaP when compared to the control group. The identification of these glycoproteins generates new perspectives and suit as indicative for guiding research and validation methods development of these results for clinical uses. Atualmente é crescente o número de estudos com base na alteração de perfis glicoproteômicos em diversas doenças, principalmente na busca de biomarcadores séricos para o câncer. A identificação e quantificação direta, de glicoproteínas sorológicas pouco abundantes, são difíceis, pois proteínas muito abundantes no sangue podem dificultar a identificação. Assim, ferramentas de fracionamento são necessárias para isolar, eficientemente, glicoformas proteicas aberrantes no proteoma sanguíneo. Tendo em vista a interação específica e reversível de lectinas com glicoconjugados, o uso de lectinas imobilizadas em matriz cromatográfica tem sido frequente, visando fracionar misturas complexas, envolvendo glicoproteínas, para posterior análise por espectrometria de massas. Mediante este contexto, o objetivo do presente trabalho foi investigar o uso da lectina glucose/ manose ligante de sementes de Dioclea altíssima (DaL) imobilizada em matriz cromatográfica Sepharose 4B® (DaL-Sepharose), no fracionamento de glicoproteínas séricas e na pesquisa de potenciais biomarcadores para o câncer de próstata (CaP). As glicoproteínas da fração retida, obtidas pela cromatografia do soro sanguíneo na matriz de DaL-Sepharose, foram identificadas e quantificadas, por espectrometria de massas, e assim, foi obtido o perfil proteico para os três grupos estudados: controle, hiperplasia prostática benigna e CaP. A identificação das proteínas diferentemente expressas entre os grupos revelou 132 glicoproteínas, destas, 29 foram unicamente identificadas no grupo com câncer de próstata ou apresentaram uma razão de ln maior que 1,2, quando comparado à quantificação no grupo controle. Após uma análise considerando a confiabilidade da identificação, estimada pelo escore, e as evidencias na literatura que justifiquem um possível envolvimento da proteína no câncer de próstata, destacaram-se: alfa-1-glicoproteína ácida, trombospondin-5, complemento C4 A, heptaglobina, pregnancy zone protein, isoforma 3 de alfa-1-antitripsina, alfa-2-glicoproteína rica em leucina e Zinc finger protein. A análise do soro sanguíneo fracionado pela matriz DaL-Sepharose, com prévia depleção de Albumina sérica humana e IgG, permitiu a identificação de alfa-1-antitripsina e a proteína IGK “únicas” no grupo com CaP e a pregnancy zone protein e a proteína like alfa 1 mieloma up reguladas no CaP quando comparadas ao grupo controle. A identificação destas glicoproteínas gera novas perspectivas e servem de indicativo para nortear a pesquisa e desenvolvimento de métodos de validação destes resultados para usos clínicos.
- Published
- 2014
182. Gene and protein expression in the reproductive tract of Brazilian Somalis rams.
- Author
-
Bezerra MJB, Silva MB, Lobo CH, Vasconcelos FR, Lobo MD, Monteiro-Moreira ACO, Moreira RA, Machado-Neves M, Figueiredo JR, and Moura AA
- Subjects
- Adaptation, Physiological, Animals, Brazil, Clusterin genetics, Clusterin metabolism, Gene Expression, Intramolecular Oxidoreductases genetics, Intramolecular Oxidoreductases metabolism, Lipocalins genetics, Lipocalins metabolism, Male, Osteopontin genetics, Osteopontin metabolism, Tropical Climate, Genitalia, Male metabolism, Proteome analysis, Sheep, Domestic genetics, Sheep, Domestic metabolism
- Abstract
Brazilian Somalis is a locally-adapted breed of rams raised in tropical climate and native pastures. The present study was conducted to evaluate gene expression and proteome of the reproductive tract of such rams. Samples were collected from testes, epididymides, seminal vesicles and bulbourethral glands of four rams. Expression of clusterin (CLU), osteopontin (OPN) and prostaglandin D2 synthase (PGDS) genes were evaluated in all samples by real-time PCR. Shotgun proteomic analysis was performed using samples from the head, corpus and cauda epididymides and from all other structures as well. Gene ontology terms and protein interactions were obtained from UniProtKB databases and MetaCore v.6.8 platform. CLU trasncripts were detected in the testes, epididymides, seminal vesicles and bulbourethral glands of the Somalis rams. The initial region and body of the epididymis had the greatest CLU expression. OPN mRNA was localized in all tissues of the ram reproductive tract. PGDS mRNA was detected in the testes and epididymides. Lable-free mass spectrometry allowed the identification of 137 proteins in all samples. Proteins of the epididymis head mainly participate in cellular processes and response to stimulus, participating in catalityc activity and binding. Proteins of epididymis body acted as regulatory proteins and in cellular processes, with binding and catalytic activity. Cauda epididymis molecules were associated with cellular processes and regulation, with binding function and catalytic activity as well. Testis proteins were mainly linked to cell processes and response to stimuli, and had catalytic function. Seminal vesicle proteins were involved in regulation and mainly with binding functions. Most bulbourethral gland proteins participated in cellular processes. The present study is the first to evaluate the proteome and gene expressions in the reproductive tract of Brazilian Somalis rams. Such pieces of information bring significant cointribution for the understanding of the reproductive physiology of locally-adapted livestock., (© 2018 Blackwell Verlag GmbH.)
- Published
- 2019
- Full Text
- View/download PDF
183. New structural insights into anomeric carbohydrate recognition by frutalin: an α-d-galactose-binding lectin from breadfruit seeds.
- Author
-
Vieira Neto AE, de Sousa FD, Pereira HD, Moreno FBMB, Lourenzoni MR, Grangeiro TB, Monteiro Moreira ACO, and Moreira RA
- Subjects
- Binding Sites, Structure-Activity Relationship, Substrate Specificity, Artocarpus chemistry, Galactose chemistry, Galectins chemistry, Seeds chemistry
- Abstract
Frutalin (FTL) is a multiple-binding lectin belonging to the jacalin-related lectin (JRL) family and derived from Artocarpus incisa (breadfruit) seeds. This lectin specifically recognizes and binds α-d-galactose. FTL has been successfully used in immunobiological research for the recognition of cancer-associated oligosaccharides. However, the molecular bases by which FTL promotes these specific activities remain poorly understood. Here, we report the whole 3D structure of FTL for the first time, as determined by X-ray crystallography. The obtained crystals diffracted to 1.81 Å (Apo-frutalin) and 1.65 Å (frutalin-d-Gal complex) of resolution. The lectin exhibits post-translational cleavage yielding an α- (133 amino acids) and β-chain (20 amino acids), presenting a homotetramer when in solution, with a typical JRL β-prism. The β-prism was composed of three 4-stranded β-sheets forming three antiparallel Greek key motifs. The carbohydrate-binding site (CBS) involved the N-terminus of the α-chain and was formed by four key residues: Gly25, Tyr146, Trp147 and Asp149. Together, these results were used in molecular dynamics simulations in aqueous solutions to shed light on the molecular basis of FTL-ligand binding. The simulations suggest that Thr-Ser-Ser-Asn (TSSN) peptide excision reduces the rigidity of the FTL CBS, increasing the number of interactions with ligands and resulting in multiple-binding sites and anomeric recognition of α-d-galactose sugar moieties. Our findings provide a new perspective to further elucidate the versatility of FTL in many biological activities., (© 2019 The Author(s). Published by Portland Press Limited on behalf of the Biochemical Society.)
- Published
- 2019
- Full Text
- View/download PDF
184. Hydrogel and membrane scaffold formulations of Frutalin (breadfruit lectin) within a polysaccharide galactomannan matrix have potential for wound healing.
- Author
-
de Sousa FD, Vasconselos PD, da Silva AFB, Mota EF, da Rocha Tomé A, Mendes FRDS, Gomes AMM, Abraham DJ, Shiwen X, Owen JS, Lourenzoni MR, Campos AR, Moreira RA, and Monteiro-Moreira ACO
- Subjects
- Animals, Anti-Infective Agents chemistry, Anti-Infective Agents pharmacology, Cell Line, Galactose analogs & derivatives, Humans, Mice, Models, Molecular, Protein Conformation, Toll-Like Receptor 4 chemistry, Toll-Like Receptor 4 metabolism, Biocompatible Materials chemistry, Biocompatible Materials pharmacology, Galectins chemistry, Hydrogels chemistry, Mannans chemistry, Membranes, Artificial, Wound Healing drug effects
- Abstract
Plant lectins are carbohydrate-binding proteins, which can interact with cell surfaces to initiate anti-inflammatory pathways, as well as immunomodulatory functions. Here, we have extracted, purified and part-characterized the bioactivity of Jacalin, Frutalin, DAL and PNA, before evaluating their potential for wound healing in cultured human skin fibroblasts. Only Frutalin stimulated fibroblast migration in vitro, prompting further studies which established its low cytotoxicity and interaction with TLR4 receptors. Frutalin also increased p-ERK expression and stimulated IL-6 secretion. The in vivo potential of Frutalin for wound healing was then assessed in hybrid combination with the polysaccharide galactomannan, purified from Caesalpinia pulcherrima seeds, using both hydrogel and membrane scaffolds formulations. Physical-chemical characterization of the hybrid showed that lectin-galactomannan interactions increased the pseudoplastic behaviour of solutions, reducing viscosity and increasing Frutalin's concentration. Furthermore, infrared spectroscopy revealed -OH band displacement, likely caused by interaction of Frutalin with galactose residues present on galactomannan chains, while average membrane porosity was 100 μm, sufficient to ensure water vapor permeability. Accelerated angiogenesis and increased fibroblast and keratinocyte proliferation were observed with the optimal hybrid recovering the lesioned area after 11 days. Our findings indicate Frutalin as a biomolecule with potential for tissue repair, regeneration and chronic wound healing., (Copyright © 2018. Published by Elsevier B.V.)
- Published
- 2019
- Full Text
- View/download PDF
185. Differences in protein expression associated with ivermectin resistance in Caenorhabditis elegans.
- Author
-
Sousa DM, Cunha NMFD, Silva DRD, Aragão PTTD, Aguiar MVA, Lobo MDP, Moreira ACOM, Cunha RMSD, Miranda RRC, and Bevilaqua CML
- Subjects
- Animals, Caenorhabditis elegans metabolism, Electrophoresis, Polyacrylamide Gel, Helminth Proteins drug effects, Antiparasitic Agents pharmacology, Caenorhabditis elegans drug effects, Drug Resistance drug effects, Helminth Proteins metabolism, Ivermectin pharmacology
- Abstract
The indiscriminate administration of synthetic anthelmintics such as ivermectin contributes to the selection of subpopulations capable of resisting the drugs' effects. To understand the mechanisms of ivermectin resistance in Caenorhabditis elegans, this study attempted to identify molecular targets. C. elegans lineages that were sensitive and resistant to ivermectin were used. Collected nematodes were added to an extraction buffer and macerated in liquid nitrogen for protein extraction. The extracted proteins were separated according to molecular weight by SDS-PAGE to verify their integrity. Subsequently, proteins from both lineages were separated using two-dimensional electrophoresis. The gels were analyzed and the relevant spots were excised and identified by mass spectrometry (NanoESI-Q-TOF and MASCOT®) and subsequently assessed by GO enrichment and STRING® analyses. The increased expression of proteins associated with high metabolic activity, such as ATP-2 and ENOL-1, which are responsible for ATP synthesis, was observed. Furthermore, proteins with involvement in mediating muscular function (MLC-1, ACT-1, and PDI-2), signaling (FAR-1 and FAR-2), and embryo development (VHA-2) were identified. Protein interaction analysis indicated that the majority of the identified proteins in the resistant lineages participated in the same reaction triggered by ivermectin.
- Published
- 2019
- Full Text
- View/download PDF
186. Antinociceptive activity of ethanolic extract of Azadirachta indica A. Juss (Neem, Meliaceae) fruit through opioid, glutamatergic and acid-sensitive ion pathways in adult zebrafish (Danio rerio).
- Author
-
Batista FLA, Lima LMG, Abrante IA, de Araújo JIF, Batista FLA, Abrante IA, Magalhães EA, de Lima DR, Lima MDCL, do Prado BS, Moura LFWG, Guedes MIF, Ferreira MKA, de Menezes JESA, Santos SAAR, Mendes FRS, Moreira RA, Monteiro-Moreira ACO, Campos AR, and Magalhães FEA
- Subjects
- Acid Sensing Ion Channels metabolism, Animals, Antioxidants metabolism, Disease Models, Animal, Ethanol, Flavonoids pharmacology, Locomotion drug effects, Morphine pharmacology, Pain drug therapy, Pain metabolism, Receptors, N-Methyl-D-Aspartate metabolism, Zebrafish, Analgesics pharmacology, Analgesics, Opioid pharmacology, Azadirachta chemistry, Excitatory Amino Acid Agents pharmacology, Fruit chemistry, Meliaceae chemistry, Plant Extracts pharmacology
- Abstract
Neem fruit (Azadirachta indica A. Juss.) are popularly used to treat infections, diarrhea, fever, bronchitis, skin diseases, infected burns and hypertension. Although the antinociceptive and anti-inflammatory potential of A. indica has already been investigated in experimental models of pain and inflammation in mice, the current research is the first to report the evaluation of the capacity of A. indica fruit ethanolic extract (EtFrNeem) in acute pain attenuation using the adult zebrafish (Danio rerio) as an alternative model to the use in rodents. EtFrNeem was submitted to antioxidant action, preliminary chemical prospecting, FT-IR and determination of phenol and flavonoid content tests. Subsequently, EtFrNeem was tested for acute nociception and abdominal inflammation, locomotor activity, and acute toxicity in adult zebrafish. Possible neuromodulation mechanisms were also evaluated. EtFrNeem showed low antioxidant activity, but was shown to be rich in flavonoids. EtFrNeem showed no anti-inflammatory action, did not alter the locomotor system, and it was not toxic. However, EtFrNeem significantly reduced the nociceptive behavior induced by formalin, glutamate and acidic saline, when compared to the control group. These effects of EtFrNeem were significantly similar to those of morphine, used as a positive control. The antinociceptive effect of EtFrNeem was inhibited by naloxone, ketamine and amiloride. EtFrNeem has the pharmacological potential for acute pain treatment and this effect is modulated by the opioid system, NMDA receptors and ASICs channels. These results lead us to studies of isolation and characterization of EtFrNeem bioactive principles, using adult zebrafish as an experimental model., (Copyright © 2018 Elsevier Masson SAS. All rights reserved.)
- Published
- 2018
- Full Text
- View/download PDF
187. Proteomic identification and purification of seed proteins from native Amazonian species displaying antifungal activity.
- Author
-
Ramos MV, Brito D, Freitas CDT, Gonçalves JFC, Porfirio CTMN, Lobo MDP, Monteiro-Moreira ACO, Souza LAC, and Fernandes AV
- Subjects
- Chitinases isolation & purification, Chitinases pharmacology, Electrophoresis, Polyacrylamide Gel, Fabaceae chemistry, Fusarium drug effects, Lectins isolation & purification, Lectins pharmacology, Mass Spectrometry, Microscopy, Fluorescence, Plant Proteins pharmacology, Proteomics, Rainforest, Spores, Fungal drug effects, Antifungal Agents isolation & purification, Plant Proteins isolation & purification, Seeds chemistry
- Abstract
Main Conclusion: Seeds of native species from the rain forest (Amazon) are source of chitinases and their protein extracts exhibited strong and broad antifungal activity. Numerous plant species native to the Amazon have not yet been chemically studied. Studies of seeds are scarcer, since adversities in accessing study areas and seasonality pose constant hurdles to systematic research. In this study, proteins were extracted from seeds belonging to endemic Amazon species and were investigated for the first time. Proteolytic activity, peptidase inhibitors, and chitinases were identified, but chitinolytic activity predominated. Four proteins were purified through chromatography and identified as lectin and chitinases by MS/MS analyses. The proteins were examined for inhibition of a phytopathogen (Fusarium oxysporum). Analyses by fluorescence microscopy suggested binding of propidium iodide to DNA of fungal spores, revealing that spore integrity was lost when accessed by the proteins. Further structural and functional analyses of defensive proteins belonging to species facing highly complex ecosystems such as Amazonia should be conducted, since these could provide new insights into specificity and synergism involving defense proteins of plants submitted to a very complex ecosystem.
- Published
- 2018
- Full Text
- View/download PDF
188. Proteomic analysis to identify candidate biomarkers associated with type 1 diabetes.
- Author
-
do Nascimento de Oliveira V, Lima-Neto ABM, van Tilburg MF, de Oliveira Monteiro-Moreira AC, Duarte Pinto Lobo M, Rondina D, Fernandes VO, Montenegro APDR, Montenegro RM Júnior, and Guedes MIF
- Abstract
Purpose: Type 1 diabetes mellitus (DM1) is one of the most common chronic diseases observed during childhood. The incidence of DM1 is increasing worldwide, and there is currently no way to prevent or delay the onset or to cure the disease. Most diseases, including diabetes, stem from abnormalities in the functioning of proteins, and some studies have reported the expression of protein variation to be involved in the development of DM1. Thus, the aim of this study was to investigate the differential expression of serum proteins in patients with DM1., Materials and Methods: Serum of patients with DM1 (n=30) and healthy controls (n=30) was collected. A proteomic approach was used with depletion of albumin and immunoglobulin G chromatography on serum samples followed by data-independent, label-free mass spectrometric analysis., Results: A total of eight serum proteins were identified as being differentially expressed and involved in the immune system, lipid metabolism, and pathways of coagulation. DM1 was associated with the upregulation of six proteins: alpha-2-macroglobulin, apolipoprotein A-II, β2 glycoprotein I, Ig alpha-2 chain C region, alpha-1-microglobulin, and prothrombin. A total of two proteins were downregulated, including pregnancy zone protein and complement C4., Conclusion: To the best of our knowledge, these findings show differential expression of proteins revealing new proteins that may be involved in the development and progression of diabetes., Competing Interests: Disclosure The authors report no conflicts of interest in this work.
- Published
- 2018
- Full Text
- View/download PDF
189. Neuropharmacological characterization of frutalin in mice: Evidence of an antidepressant-like effect mediated by the NMDA receptor/NO/cGMP pathway.
- Author
-
Araújo JRC, Júnior JMAM, Damasceno MBMV, Santos SAAR, Vieira-Neto AE, Lobo MDP, Campos AR, Moreira RA, and Monteiro-Moreira ACO
- Subjects
- Animals, Galectins chemistry, Galectins isolation & purification, Hindlimb Suspension, Maze Learning drug effects, Mice, Molecular Docking Simulation, Protein Domains, Swimming, Antidepressive Agents pharmacology, Cyclic GMP metabolism, Galectins pharmacology, Nitric Oxide metabolism, Receptors, N-Methyl-D-Aspartate metabolism, Signal Transduction drug effects
- Abstract
In this study we evaluated the effect of frutalin (FTL) on mouse behavior. Mice (n=6/group) were treated (i.p.) with FTL (0.25; 0.5 or 1mg/kg) or vehicle and submitted to several tests (hole-board/HBT, elevated plus maze/PMT, open field/OFT, tail suspension/TST, or forced swimming/FST). Yohimbine, ketamine, l-NAME, aminoguanidine, 7-NI, methylene blue, l-arginine or dl-serine was administered 30min before FTL (0.5mg/kg). To evaluate the subchronic effect, animals were injected with FTL or vehicle for 7days and submitted to the FST. Molecular docking was simulated using FTL against NOS and the NMDA receptor. No changes were observed in the HBT or the OFT. FTL (0.25mg/kg) increased the number of entries into enclosed arms in the PMT. FTL reduced immobility in the TST (0.25 and 0.5mg/kg) and the FST (0.25mg/kg; 0.5mg/kg). The effect of FTL was dependent on carbohydrate interaction and protein structure integrity and was reduced by ketamine, l-NAME, aminoguanidine, 7-NI and methylene blue, but not by l-arginine, yohimbine or dl-serine. The antidepressant-like effect remained after subchronic treatment. The molecular docking study revealed a strong interaction between FTL and NOS and NMDA. FTL was found to have an antidepressant-like effect mediated by the NMDA receptor/NO/cGMP pathway., (Copyright © 2018 Elsevier B.V. All rights reserved.)
- Published
- 2018
- Full Text
- View/download PDF
190. Pattern of protein expression in the epididymis of Oligoryzomys nigripes (Cricetidae, Sigmodontinae).
- Author
-
Menezes TP, Hill E, de Alencar Moura A, Lobo MDP, Monteiro-Moreira ACO, Breton S, and Machado-Neves M
- Subjects
- Animals, Epididymis anatomy & histology, Epididymis cytology, Gene Ontology, Imaging, Three-Dimensional, Male, Molecular Sequence Annotation, Proteomics, Epididymis metabolism, Proteins metabolism, Sigmodontinae metabolism
- Abstract
In the epididymis, epithelial cells work in a concerted manner to create a luminal environment for sperm maturation, transport, and storage. However, the cell functions may be affected by anthropogenic factors, causing negative impacts on male fertility. In our study, we describe the pattern of protein expression in the epithelium and luminal fluid from epididymis of Oligoryzomys nigripes, a South American sigmodontine rodent whose reproductive biology has been little studied. Nine animals were captured from a preserved area of Atlantic Forest, where the exposure to anthropogenic influences is minimal. Epididymides were processed for histological analysis under light and epifluorescence microscopy, in which we used cell-specific markers aquaporin 9 (AQP9), vacuolar H
+ -ATPase (V-ATPase), and cytokeratin 5 (KRT5). Other samples were assessed for protein expression using shotgun proteomics. Similar to laboratory rodents, principal cells expressed AQP9 in their stereocilia. Basal cells, identified by KRT5 labeling, presented lateral body projections and a few axiopodia going toward the lumen. Clear cells expressed V-ATPase in their sub-apical vesicles and microplicae, and showed different shapes along the duct. Shotgun proteomics detected 51 proteins from epididymal supernatant. Most of them have been previously described in other species, indicating that they are well conserved. Twenty-three proteins detected in O. nigripes have not been described in epididymis from other South American sigmodontine rodents, confirming that the secretion pattern is species-specific. Our findings in O. nigripes from a protected area may help to create a baseline for studies investigating the effects of anthropogenic factors on functionality of the epididymal epithelium.- Published
- 2018
- Full Text
- View/download PDF
191. Action mechanism of naphthofuranquinones against fluconazole-resistant Candida tropicalis strains evidenced by proteomic analysis: The role of increased endogenous ROS.
- Author
-
de Andrade Neto JB, da Silva CR, Campos RS, do Nascimento FBSA, Sampaio LS, da Silva AR, Josino MAA, de Moraes MO, Lobo MDP, Moreno FBMB, Moreira ACOM, de Azevedo Moreira R, Grangeiro TB, da Silva Júnior EN, Magalhães HIF, Rocha DD, Cavalcanti BC, and Júnior HVN
- Subjects
- Antifungal Agents chemical synthesis, Antifungal Agents chemistry, Candida tropicalis genetics, Candidemia microbiology, Cell Cycle drug effects, DNA Damage drug effects, DNA, Fungal genetics, Energy Metabolism drug effects, Fluconazole pharmacology, Glycolysis drug effects, Membrane Potential, Mitochondrial drug effects, Microbial Sensitivity Tests, Mitochondria drug effects, Naphthoquinones chemical synthesis, Naphthoquinones chemistry, Stress, Psychological, Antifungal Agents pharmacology, Candida tropicalis drug effects, Candida tropicalis metabolism, Drug Resistance, Fungal drug effects, Drug Resistance, Fungal physiology, Naphthoquinones pharmacology, Proteomics, Reactive Oxygen Species metabolism
- Abstract
The increased incidence of candidemia in terciary hospitals worldwide and the cross-resistance frequency require the new therapeutic strategies development. Recently, our research group demonstrated three semi-synthetic naphthofuranquinones (NFQs) with a significant antifungal activity in a fluconazole-resistant (FLC) C. tropicalis strain. The current study aimed to investigate the action's preliminary mechanisms of NFQs by several standardized methods such as proteomic and flow cytometry analyzes, comet assay, immunohistochemistry and confocal microscopy evaluation. Our data showed C. tropicalis 24 h treated with all NFQs induced an expression's increase of proteins involved in the metabolic response to stress, energy metabolism, glycolysis, nucleosome assembly and translation process. Some aspects of proteomic analysis are in consonance with our flow cytometry analysis which indicated an augmentation of intracellular ROS, mitochondrial dysfunction and DNA strand breaks (neutral comet assay and γ-H2AX detection). In conclusion, our data highlights the great contribution of ROS as a key event, probably not the one, associated to anti-candida properties of studied NFQs., (Copyright © 2017 Elsevier Ltd. All rights reserved.)
- Published
- 2018
- Full Text
- View/download PDF
192. A panel of protein candidates for comprehensive study of Caprine Arthritis Encephalitis (CAE) infection.
- Author
-
Bezerra Júnior RQ, Eloy ÂMX, Furtado JR, Pinheiro RR, Andrioli A, Moreno FB, Pinto Lobo MD, Monteiro-Moreira ACO, de Azevedo Moreira R, Farias Pinto TM, and da Silva Teixeira MF
- Subjects
- Animals, Blotting, Western veterinary, Electrophoresis, Gel, Two-Dimensional veterinary, Goat Diseases virology, Goats genetics, Lentivirus Infections diagnosis, Lentivirus Infections virology, Male, Polymerase Chain Reaction veterinary, Semen chemistry, Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization veterinary, Arthritis-Encephalitis Virus, Caprine isolation & purification, Goat Diseases diagnosis, Lentivirus Infections veterinary, Seminal Plasma Proteins analysis
- Abstract
The caprine arthrite encephalite (CAE) is a disease that affects especially dairy goat. The virus shows compartmentalization features, that allows it to hide at certain times during the course of the disease, making it difficult to control. The present study was conducted to identify the major seminal plasma protein profile of goats infected by CAE and its associations with seroconversion using Western blotting. Two groups containing five males each, were used in this experiment. The first group was composed by seropositive animals and the control by seronegative confirmed by Western blotting and PCR. The semen was collected through artificial vagina and after that, two-dimensional electrophoresis and MALDI-TOF MS were used. Seventy-five spots were identified in the goat seminal plasma gels, equivalent to 13 different proteins with more expression. The similar proteins found in both groups and related to reproduction were spermadhesin Z13-like, bodhesin and bodhesin-2, Lipocalin, protein PDC-109-like, and albumin. In infected goats, proteases such as arisulfatase A have been identified, whose function probably is related to metabolism control of sulfatides, involved to virus control. The other ones were bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase, cathepsin F isoform X1, disintegrin and metalloproteinase domain-containing protein 2-like isoform X1, clusterin, carbonic anhydrase 2, electron transfer flavoprotein subunit beta, and epididymal secretory glutathione peroxidase. The results of this study show the reaction of the innate immune system against chronic infection of goats by CAE.
- Published
- 2018
- Full Text
- View/download PDF
193. First insights into the diversity and functional properties of chitinases of the latex of Calotropis procera.
- Author
-
Freitas CDT, Viana CA, Vasconcelos IM, Moreno FBB, Lima-Filho JV, Oliveira HD, Moreira RA, Monteiro-Moreira ACO, and Ramos MV
- Subjects
- Animals, Antifungal Agents pharmacology, Calotropis chemistry, Calotropis physiology, Chitinases isolation & purification, Chitinases pharmacology, Coleoptera drug effects, Glycosylation, Hydrogen-Ion Concentration, Insecticides pharmacology, Latex metabolism, Protein Isoforms metabolism, Temperature, Calotropis enzymology, Chitinases metabolism, Latex chemistry
- Abstract
Chitinases (EC 3.2.1.14) found in the latex of Calotropis procera (Ait) R. Br. were studied. The proteins were homogeneously obtained after two ion exchange chromatography steps. Most proteins were identified individually in 15 spots on 2-D gel electrophoresis with isoelectric points ranging from 4.6 to 6.0 and molecular masses extending from 27 to 30 kDa. Additionally, 66 kDa proteins were identified as chitinases in SDS-PAGE. Their identities were further confirmed by mass spectrometry (MS) analysis of the tryptic digests of each spot and MS analysis of the non-digested proteins. Positive reaction for Schiff's reagent suggested the proteins are glycosylated. The chitinases exhibited high catalytic activity toward to colloidal chitin at pH 5.0, and this activity underwent decay in the presence of increasing amounts of reducing agent dithiothreitol. Spore germination and hyphae growth of two phytopathogenic fungi were inhibited only marginally by the chitinases but were affected differently. This suggested a complex relationship might exist between the specificity of the proteins toward the fungal species. The chitinases showed potent insecticidal activity against the Bruchidae Callosobruchus maculatus, drastically reducing survival, larval weight and adult emergence. It is concluded that closely related chitinases are present in the latex of C. procera, and the first experimental evidence suggests these proteins are involved more efficiently in defence strategies against insects rather than fungi., (Copyright © 2016 Elsevier Masson SAS. All rights reserved.)
- Published
- 2016
- Full Text
- View/download PDF
194. Frutalin reduces acute and neuropathic nociceptive behaviours in rodent models of orofacial pain.
- Author
-
Damasceno MB, de Melo Júnior Jde M, Santos SA, Melo LT, Leite LH, Vieira-Neto AE, Moreira Rde A, Monteiro-Moreira AC, and Campos AR
- Subjects
- Acute Pain drug therapy, Acute Pain metabolism, Analgesics isolation & purification, Animals, Artocarpus chemistry, Disease Models, Animal, Facial Pain metabolism, Galectins isolation & purification, Mice, Molecular Docking Simulation, Neuralgia, Rats, Wistar, TRPM Cation Channels metabolism, TRPV Cation Channels metabolism, Transient Receptor Potential Channels metabolism, Analgesics therapeutic use, Facial Pain drug therapy, Galectins therapeutic use
- Abstract
Orofacial pain is a highly prevalent clinical condition, yet difficult to control effectively with available drugs. Much attention is currently focused on the anti-inflammatory and antinociceptive properties of lectins. The purpose of this study was to evaluate the antinociceptive effect of frutalin (FTL) using rodent models of inflammatory and neuropathic orofacial pain. Acute pain was induced by formalin, glutamate or capsaicin (orofacial model) and hypertonic saline (corneal model). In one experiment, animals were pretreated with l-NAME and naloxone to investigate the mechanism of antinociception. The involvement of the lectin domain in the antinociceptive effect of FTL was verified by allowing the lectin to bind to its specific ligand. In another experiment, animals pretreated with FTL or saline were submitted to the temporomandibular joint formalin test. In yet another, animals were submitted to infraorbital nerve transection to induce chronic pain, followed by induction of thermal hypersensitivity using acetone. Motor activity was evaluated with the rotarod test. A molecular docking was performed using the TRPV1 channel. Pretreatment with FTL significantly reduced nociceptive behaviour associated with acute and neuropathic pain, especially at 0.5 mg/kg. Antinociception was effectively inhibited by l-NAME and d-galactose. In line with in vivo experiments, docking studies indicated that FTL may interact with TRPV1. Our results confirm the potential pharmacological relevance of FTL as an inhibitor of orofacial nociception in acute and chronic pain mediated by TRPA1, TRPV1 and TRPM8 receptor., (Copyright © 2016. Published by Elsevier Ireland Ltd.)
- Published
- 2016
- Full Text
- View/download PDF
195. First isolation and antinociceptive activity of a lipid transfer protein from noni (Morinda citrifolia) seeds.
- Author
-
Campos DC, Costa AS, Lima AD, Silva FD, Lobo MD, Monteiro-Moreira AC, Moreira RA, Leal LK, Miron D, Vasconcelos IM, and Oliveira HD
- Subjects
- Amino Acid Sequence, Analgesics chemistry, Animals, Antigens, Plant chemistry, Carrier Proteins chemistry, Dose-Response Relationship, Drug, Drug Stability, Male, Mice, Plant Proteins chemistry, Reflex drug effects, Analgesics isolation & purification, Analgesics pharmacology, Antigens, Plant isolation & purification, Antigens, Plant pharmacology, Carrier Proteins isolation & purification, Carrier Proteins pharmacology, Morinda chemistry, Plant Proteins isolation & purification, Plant Proteins pharmacology, Seeds chemistry
- Abstract
In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein., (Copyright © 2016 Elsevier B.V. All rights reserved.)
- Published
- 2016
- Full Text
- View/download PDF
196. Further evidences for the mode of action of the larvicidal m-pentadecadienyl-phenol isolated from Myracrodruon urundeuva seeds against Aedes aegypti.
- Author
-
Souza TM, Menezes ESB, Oliveira RV, Almeida Filho LCP, Martins JM, Moreno FB, Monteiro-Moreira ACO, Moura AAA, and Carvalho AFU
- Subjects
- Animals, Dengue prevention & control, Insecticides isolation & purification, Insecticides pharmacology, Plant Extracts isolation & purification, Aedes drug effects, Anacardiaceae chemistry, Larva drug effects, Phenols isolation & purification, Phenols pharmacology, Plant Extracts pharmacology, Seeds chemistry
- Abstract
Nowadays, dengue fever is considered the most important arbovirosis worldwide and its control is still based upon combating the vector Aedes aegypti. Besides monitoring of mosquito populations resistant to conventional insecticides, the search for new environmentally safe insecticides and conduction of molecular studies focusing on the elucidation of mode of action and possible resistance mechanisms are considered the key for a sustainable management of the mosquito vector. Thus, the present work aimed to assess changes in protein expression of 3rd-instar larvae of Ae. aegypti after exposure to the natural insecticide m-pentadecadienyl-phenol. Bidimensional electrophoresis followed by mass spectrometry resulted in identification of 12 proteins differentially expressed between control and treated groups. Larvae exposed to the toxic compound for 24h showed elevated detoxification response (glutathione-S-transferase), increased levels of stress-related proteins (HSP70) as well as evidence of lysosome stabilization to enable survival. Furthermore, expression of proteins involved in protection of peritrophic membrane and metabolism of lipids indicated systemic effect of toxic effects in treated larvae., (Copyright © 2015 Elsevier B.V. All rights reserved.)
- Published
- 2015
- Full Text
- View/download PDF
197. Effect of increased testicular temperature on seminal plasma proteome of the ram.
- Author
-
Rocha DR, Martins JA, van Tilburg MF, Oliveira RV, Moreno FB, Monteiro-Moreira AC, Moreira RA, Araújo AA, and Moura AA
- Subjects
- Animals, Male, Organ Size, Protein Interaction Maps, Semen Analysis veterinary, Sheep physiology, Spectrometry, Mass, Electrospray Ionization, Testis anatomy & histology, Proteome, Semen metabolism, Sheep metabolism, Temperature, Testis physiology
- Abstract
The present study evaluated the effects of heat stress on the ram seminal plasma proteome. Six Morada Nova rams were scrotal insulated for 8 days. Scrotal circumference, sperm parameters, and seminal fluid proteins were evaluated before (Day 0) and twice during scrotal insulation (Days 4 and 8), and weekly until semen parameters returned to preinsulation values (normal). Seminal proteins were analyzed by two-dimensional SDS-PAGE and mass spectrometry. Scrotal circumference decreased from 30 ± 0.4 cm on Day 0 to 22.6 ± 0.6 cm on Day 36 (P < 0.05) and became equivalent to preinsulation values on Day 71. Motile sperm became nearly absent from Day 8 to Day 64 but returned to normal on Day 113. Percentage of normal sperm changed similarly and returned to normal on Day 106. Rams were azoospermic between Days 29 and 64, and sperm concentration came back to normal on Day 92. The number of spots/two-dimensional gel reduced from 256 ± 31 on Day 0 to 104 ± 14 on Day 29 (when rams were azoospermic) and then increased to 183 ± 9 on Day 113 (P < 0.05), similar to spot counts before insulation. The intensities of 24 spots, referring to 17 seminal plasma proteins, were affected by treatment (P < 0.05). After insulation, seminal plasma had greater expression of actin (two isoforms), albumin, heat shock protein 70 kDa, protein DJ-1, HRPE773-like, C-reactive protein precursor, bodhesin-2 (one isoform), spermadhesins. Most protein spots had the greatest intensity between Days 8 and 29, returning to preinsulation values on Day 113 (when many sperm criteria returned to normal). Proteins downregulated after scrotal insulation included dipeptidyl peptidase 3, isoforms of heat shock protein 90 kDa, RSVP22, MMP2 and of Bdh2. In this case, RSVP22 was reduced on Day 113 and all others, on Day 134. Expression of MMP2 and HSP90.1 was reduced throughout the study. Integrin β5, V-type H(+)-ATPase subunit A, ZBTB 42-like protein, isoforms of Bdh2, PSP-I, and RSVP22 were upregulated after testis insulation. Intensities of these spots were maximum (P < 0.05) 8 days after insulation started or on Day 29. Expression of most of such proteins returned to normal on Day 113. In conclusion, scrotal insulation affected testis and sperm parameters of rams, indicating alterations in both spermatogenesis and sperm maturation. Changes of seminal plasma proteome were coincidental with variations in semen parameters. Proteins affected by heat challenge are potentially involved in sperm protection, maturation, and fertilization., (Copyright © 2015 Elsevier Inc. All rights reserved.)
- Published
- 2015
- Full Text
- View/download PDF
198. Seminal plasma proteins of adult boars and correlations with sperm parameters.
- Author
-
González-Cadavid V, Martins JA, Moreno FB, Andrade TS, Santos AC, Monteiro-Moreira AC, Moreira RA, and Moura AA
- Subjects
- Animals, Male, Semen metabolism, Semen Analysis veterinary, Seminal Plasma Proteins genetics, Gene Expression Regulation physiology, Semen chemistry, Seminal Plasma Proteins metabolism, Spermatozoa physiology, Swine physiology
- Abstract
The present study was conducted to identify the major seminal plasma protein profile of boars and its associations with semen criteria. Semen samples were collected from 12 adult boars and subjected to evaluation of sperm parameters (motility, morphology, vitality, and percent of cells with intact acrosome). Seminal plasma was obtained by centrifugation, analyzed by two-dimensional SDS-PAGE, and proteins identified by mass spectrometry (electrospray ionization quadrupole time-of-flight). We tested regression models using spot intensities related to the same proteins as independent variables and semen parameters as dependent variables (P ≤ 0.05). One hundred twelve spots were identified in the boar seminal plasma gels, equivalent to 39 different proteins. Spermadhesin porcine seminal protein (PSP)-I and PSP-II, as well as spermadhesins AQN-1, AQN-3 and AWN-1 represented 45.2 ± 8% of the total intensity of all spots. Other proteins expressed in the boar seminal plasma included albumin, complement proteins (complement factor H precursor, complement C3 precursor and adipsin/complement factor D), immunoglobulins (IgG heavy chain precursor, IgG delta heavy chain membrane bound form, IgG gamma-chain, Ig lambda chain V-C region PLC3, and CH4 and secreted domains of swine IgM), IgG-binding proteins, epididymal-specific lipocalin 5, epididymal secretory protein E1 precursor, epididymal secretory glutathione peroxidase precursor, transferrin, lactotransferrin and fibronectin type 1 (FN1). On the basis of the regression analysis, the percentage of sperm with midpiece defects was related to the amount of CH4 and secreted domains of swine IgM and FN1 (r² = 0.58, P = 0.006), IgG-binding protein (r² = 0.41, P = 0.024), complement factor H precursor (r² = 0.61, P = 0.014) and lactadherin (r² = 0.45, P = 0.033). The percentage of sperm with tail defects was also related to CH4 and secreted domains of swine IgM and FN1 (r² = 0.40, P = 0.034), IgG-binding protein (r² = 0.35, P = 0.043) and lactadherin (r² = 0.74, P = 0.001). Sperm motility, in turn, had association with the intensities of spots identified as lactadherin (r² = 0.48, P = 0.027). In conclusion, we presently describe the major proteome of boar seminal plasma and significant associations between specific seminal plasma proteins and semen parameters. Such relationships will serve as the basis for determination of molecular markers of sperm function in the swine species., (Copyright © 2014 Elsevier Inc. All rights reserved.)
- Published
- 2014
- Full Text
- View/download PDF
199. Proteomic analysis of salt stress and recovery in leaves of Vigna unguiculata cultivars differing in salt tolerance.
- Author
-
de Abreu CE, Araújo Gdos S, Monteiro-Moreira AC, Costa JH, Leite Hde B, Moreno FB, Prisco JT, and Gomes-Filho E
- Subjects
- Down-Regulation, Electrophoresis, Gel, Two-Dimensional, Fabaceae genetics, Gene Expression Regulation, Plant, Mass Spectrometry, Plant Leaves genetics, Plant Leaves physiology, Plant Proteins genetics, Salt Tolerance, Sodium pharmacology, Fabaceae physiology, Plant Proteins metabolism, Proteome, Proteomics, Stress, Physiological
- Abstract
Key Message: Cowpea cultivars differing in salt tolerance reveal differences in protein profiles and adopt different strategies to overcome salt stress. Salt-tolerant cultivar shows induction of proteins related to photosynthesis and energy metabolism. Salinity is a major abiotic stress affecting plant cultivation and productivity. The objective of this study was to examine differential proteomic responses to salt stress in leaves of the cowpea cultivars Pitiúba (salt tolerant) and TVu 2331 (salt sensitive). Plants of both cultivars were subjected to salt stress (75 mM NaCl) followed by a recovery period of 5 days. Proteins extracted from leaves of both cultivars were analyzed by two-dimensional electrophoresis (2-DE) under salt stress and after recovery. In total, 22 proteins differentially regulated by both salt and recovery were identified by LC-ESI-MS/MS. Our current proteome data revealed that cowpea cultivars adopted different strategies to overcome salt stress. For the salt-tolerant cultivar (Pitiúba), increase in abundance of proteins involved in photosynthesis and energy metabolism, such as rubisco activase, ribulose-5-phosphate kinase (Ru5PK) (EC 2.7.1.19), glycine decarboxylase (EC 1.4.4.2) and oxygen-evolving enhancer (OEE) protein 2, was observed. However, these vital metabolic processes were more profoundly affected in salt-sensitive cultivar (TVu), as indicated by the down-regulation of OEE protein 1, Mn-stabilizing protein-II, carbonic anhydrase (EC 4.2.1.1) and Rubisco (EC 4.1.1.39), leading to energy reduction and a decline in plant growth. Other proteins differentially regulated in both cultivars corresponded to different physiological responses. Overall, our results provide information that could lead to a better understanding of the molecular basis of salt tolerance and sensitivity in cowpea plants.
- Published
- 2014
- Full Text
- View/download PDF
200. Insights on the phytochemical profile (cyclopeptides) and biological activities of Calotropis procera latex organic fractions.
- Author
-
Jucá TL, Ramos MV, Moreno FB, Viana de Matos MP, Marinho-Filho JD, Moreira RA, and de Oliveira Monteiro-Moreira AC
- Subjects
- Animals, Anti-Inflammatory Agents chemistry, Anti-Inflammatory Agents pharmacology, Cell Line, Male, Peptides, Cyclic toxicity, Plant Extracts toxicity, Rats, Calotropis chemistry, Latex chemistry, Peptides, Cyclic chemistry, Peptides, Cyclic pharmacology, Plant Extracts chemistry, Plant Extracts pharmacology
- Abstract
Calotropis procera is a medicinal plant whose pharmacological properties are associated with its latex. Here, the Calotropis procera latex fractions were investigated in an attempt to trace its phytochemical profile and measure its anti-inflammatory and toxicity activity. The crude latex was partitioned, yielding five fractions (49.4% hexane, 5.2% dichloromethane, 2.0% ethyl acetate, 2.1% n-butanol, and 41.1% aqueous). Phytochemical screening and spectroscopy analysis revealed that dichloromethane is the most chemically diverse fraction. Triterpenes were detected in both the hexane and dichloromethane fractions, while flavonoids were detected in the dichloromethane and ethyl acetate fractions. These fractions were cytotoxic to cancer cell lines (LD50 0.05 to 3.9 μ g/mL) and lethal to brine shrimp (LD50 10.9 to 65.7 μ g/mL). Reduced neutrophil migration in rats was observed in carrageenan-induced peritonitis for the dichloromethane (67%), ethyl acetate (56%), and aqueous (72%) fractions. A positive reaction with tolidine and ninhydrin suggested that cyclopeptides are in the ethyl acetate fraction. It is therefore concluded that Calotropis procera latex dichloromethane and ethyl acetate fractions exhibit both in vitro and in vivo activities as well as anti-inflammatory properties. Cyclopeptide detection is especially interesting because previous attempts to investigate these low-molecular cyclic amino acid sequences in C. procera have failed.
- Published
- 2013
- Full Text
- View/download PDF
Catalog
Discovery Service for Jio Institute Digital Library
For full access to our library's resources, please sign in.