Back to Search
Start Over
Membrane interactions of microgels as carriers of antimicrobial peptides
- Source :
- Journal of Colloid and Interface Science, Journal of Colloid and Interface Science, Elsevier, 2018, 513, pp.141-150. ⟨10.1016/j.jcis.2017.11.014⟩
- Publication Year :
- 2018
- Publisher :
- HAL CCSD, 2018.
-
Abstract
- International audience; Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use
- Subjects :
- Circular dichroism
Surface Properties
[SDV]Life Sciences [q-bio]
Antimicrobial peptides
Peptide
02 engineering and technology
010402 general chemistry
Physical Chemistry
01 natural sciences
Biomaterials
Cell membrane
Colloid and Surface Chemistry
Lipid membrane
medicine
Lipid bilayer
Fysikalisk kemi
chemistry.chemical_classification
Bacteria
Chemistry
Cell Membrane
021001 nanoscience & nanotechnology
Antimicrobial
Anti-Bacterial Agents
0104 chemical sciences
Surfaces, Coatings and Films
Electronic, Optical and Magnetic Materials
medicine.anatomical_structure
Membrane
Biochemistry
Drug delivery
drug delivery
Biophysics
Microgel
0210 nano-technology
Antimicrobial peptide
Gels
Antimicrobial Cationic Peptides
Subjects
Details
- Language :
- English
- ISSN :
- 00219797 and 10957103
- Database :
- OpenAIRE
- Journal :
- Journal of Colloid and Interface Science, Journal of Colloid and Interface Science, Elsevier, 2018, 513, pp.141-150. ⟨10.1016/j.jcis.2017.11.014⟩
- Accession number :
- edsair.doi.dedup.....400c12a50cadd487c5b138e2699e1585