Search

Your search keyword '"Pan, O"' showing total 73 results
Start Over Author "Pan, O"
73 results on '"Pan, O"'

1. On the interplay between neoclassical tearing modes and nonlocal transport in toroidal plasmas.

Author

Ji, XQ, Xu, Y, Hidalgo, C, Diamond, PH, Liu, Yi, Pan, O, Shi, ZB, and Yu, DL

Subjects
Biochemistry and Cell Biology, Other Physical Sciences
Abstract

This Letter presents the first observation on the interplay between nonlocal transport and neoclassical tearing modes (NTMs) during transient nonlocal heat transport events in the HL-2A tokamak. The nonlocality is triggered by edge cooling and large-scale, inward propagating avalanches. These lead to a locally enhanced pressure gradient at the q = 3/2 (or 2/1) rational surface and hence the onset of the NTM in relatively low β plasmas (βN

Published
2016

2. The X-Point radiating regime at ASDEX Upgrade and TCV

Author

Bernert, M., Wiesen, S., Février, O., Kallenbach, A., Koenders, J.T.W., Sieglin, B., Bosman, T.O.S.J., Kool, B., van Berkel, M., Wijkamp, T.A., Stroth, U., Brida, D., Cavedon, M., David, P., Dunne, M.G., Henderson, S., Lunt, T., McDermott, R.M., Pan, O., Perek, A., Reimerdes, H., Sheikh, U., Theiler, C., Wischmeier, M., Team, EUROfusionMST1, team, TCV, Team, ASDEXUpgrade, Bernert, M, Wiesen, S, Fevrier, O, Kallenbach, A, Koenders, J, Sieglin, B, Stroth, U, Bosman, T, Brida, D, Cavedon, M, David, P, Dunne, M, Henderson, S, Kool, B, Lunt, T, Mcdermott, R, Pan, O, Perek, A, Reimerdes, H, Sheikh, U, Theiler, C, van Berkel, M, Wijkamp, T, Wischmeier, M, Group Heemels, Control Systems Technology, Science and Technology of Nuclear Fusion, Fluids and Flows, EUROfusion MST1 Team, TCV Team, and ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society

Subjects
Radiative scenario, operation, Nuclear and High Energy Physics, Nuclear Energy and Engineering, X-point radiation, Materials Science (miscellaneous), Divertor detachment, Power exhaust, Radiative scenarios, marfe
Abstract

Future fusion reactors require a safe, steady-state divertor operation. With deep divertor detachment, which is typically induced by impurity seeding, the radiation concentrates in a small region at the X-point or on closed flux surfaces above the X-point. This so-called X-point radiator (XPR) moves further inside the confined region with increasing seeding and the location can be actively controlled. At AUG, the parameter space for operation with an XPR was significantly extended, using active feedback on the XPR location. The XPR is observed in nearly the whole operational space of AUG in the high-densities or high collisionality regime. ELM suppression is consistently observed in all cases where the XPR was moved to a significant height above the X-point. Direct measurements of density and temperature from the region around the XPR using the new divertor Thomson scattering system at AUG indicate that the temperature at the location of the XPR remains high (>30eV) and only the region towards the X-point cools down further. In this cold XPR core, the temperature reduces to about 1eV. An XPR is also observed in TCV by the injection of nitrogen as extrinsic impurity. This highlights that the wall material (W for AUG, C for TCV) or machine size does not play a significant role for the existence of the regime. However, the scenario appears to be less stable in TCV. First experiments show the necessity of an active control for the XPR: Depending on the wall conditions and the nitrogen wall storage, the required nitrogen seeding level to achieve an XPR changes. Both, the low temperatures measured radially outside of the radiation zone at AUG, and the lower stability of the XPR regime at TCV with the presence of carbon are consistent with the predictions of a one-dimensional model of the XPR. However, the model would predict the development of the cold XPR core, and significant radiation at the X-point might already exist before reaching this cold temperature solution.

Published
2023

7. Overview of the TCV tokamak experimental programme

Author

Reimerdes, H. Agostini, M. Alessi, E. Alberti, S. and Andrebe, Y. Arnichand, H. Balbin, J. Bagnato, F. and Baquero-Ruiz, M. Bernert, M. Bin, W. Blanchard, P. and Blanken, T. C. Boedo, J. A. Brida, D. Brunner, S. Bogar, C. Bogar, O. Bolzonella, T. Bombarda, F. Bouquey, F. and Bowman, C. Brunetti, D. Buermans, J. Bufferand, H. and Calacci, L. Camenen, Y. Carli, S. Carnevale, D. and Carpanese, F. Causa, F. Cavalier, J. Cavedon, M. and Cazabonne, J. A. Cerovsky, J. Chandra, R. Jayalekshmi, A. Chandrarajan Chellai, O. Chmielewski, P. Choi, D. and Ciraolo, G. Classen, I. G. J. Coda, S. Colandrea, C. Dal Molin, A. David, P. de Baar, M. R. Decker, J. Dekeyser, W. de Oliveira, H. Douai, D. Dreval, M. Dunne, M. G. and Duval, B. P. Elmore, S. Embreus, O. Eriksson, F. and Faitsch, M. Falchetto, G. Farnik, M. Fasoli, A. and Fedorczak, N. Felici, F. Fevrier, O. Ficker, O. Fil, A. and Fontana, M. Fransson, E. Frassinetti, L. Furno, I and Gahle, D. S. Galassi, D. Galazka, K. Galperti, C. and Garavaglia, S. Garcia-Munoz, M. Geiger, B. Giacomin, M. and Giruzzi, G. Gobbin, M. Golfinopoulos, T. Goodman, T. and Gorno, S. Granucci, G. Graves, J. P. Griener, M. Gruca, M. Gyergyek, T. Haelterman, R. Hakola, A. Han, W. and Happel, T. Harrer, G. Harrison, J. R. Henderson, S. and Hogeweij, G. M. D. Hogge, J-P Hoppe, M. Horacek, J. and Huang, Z. Iantchenko, A. Innocente, P. Bjork, K. Insulander and Ionita-Schrittweiser, C. Isliker, H. Jardin, A. Jaspers, R. J. E. Karimov, R. Karpushov, A. N. Kazakov, Y. Komm, M. Kong, M. Kovacic, J. Krutkin, O. Kudlacek, O. and Kumar, U. Kwiatkowski, R. Labit, B. Laguardia, L. and Lammers, J. T. Laribi, E. Laszynska, E. Lazaros, A. and Linder, O. Linehan, B. Lipschultz, B. Llobet, X. Loizu, J. Lunt, T. Macusova, E. Marandet, Y. Maraschek, M. and Marceca, G. Marchetto, C. Marchioni, S. Marmar, E. S. and Martin, Y. Martinelli, L. Matos, F. Maurizio, R. and Mayoral, M-L Mazon, D. Menkovski, V Merle, A. Merlo, G. and Meyer, H. Mikszuta-Michalik, K. Cabrera, P. A. Molina and Morales, J. Moret, J-M Moro, A. Moulton, D. Muhammed, H. and Myatra, O. Mykytchuk, D. Napoli, F. Nem, R. D. and Nielsen, A. H. Nocente, M. Nowak, S. Offeddu, N. Olsen, J. Orsitto, F. P. Pan, O. Papp, G. Pau, A. Perek, A. and Pesamosca, F. Peysson, Y. Pigatto, L. Piron, C. and Poradzinski, M. Porte, L. Putterich, T. Rabinski, M. and Raj, H. Rasmussen, J. J. Ratta, G. A. Ravensbergen, T. and Ricci, D. Ricci, P. Rispoli, N. Riva, F. and Rivero-Rodriguez, J. F. Salewski, M. Sauter, O. Schmidt, B. S. Schrittweiser, R. Sharapov, S. Sheikh, U. A. Sieglin, B. Silva, M. Smolders, A. Snicker, A. Sozzi, C. and Spolaore, M. Stagni, A. Stipani, L. Sun, G. Tala, T. and Tamain, P. Tanaka, K. Biwole, A. Tema Terranova, D. and Terry, J. L. Testa, D. Theiler, C. Thornton, A. Thrysoe, A. Torreblanca, H. Tsui, C. K. Vaccaro, D. Vallar, M. and van Berkel, M. Van Eester, D. van Kampen, R. J. R. Van Mulders, S. Verhaegh, K. Verhaeghe, T. Vianello, N. and Villone, F. Viezzer, E. Vincent, B. Voitsekhovitch, I and Vu, N. M. T. Walkden, N. Wauters, T. Weisen, H. Wendler, N. Wensing, M. Widmer, F. Wiesen, S. Wischmeier, M. and Wijkamp, T. A. Wunderlich, D. Wuthrich, C. Yanovskiy, V and Zebrowski, J. EUROfusion MST1 Team

Abstract

The tokamak a configuration variable (TCV) continues to leverage its unique shaping capabilities, flexible heating systems and modern control system to address critical issues in preparation for ITER and a fusion power plant. For the 2019-20 campaign its configurational flexibility has been enhanced with the installation of removable divertor gas baffles, its diagnostic capabilities with an extensive set of upgrades and its heating systems with new dual frequency gyrotrons. The gas baffles reduce coupling between the divertor and the main chamber and allow for detailed investigations on the role of fuelling in general and, together with upgraded boundary diagnostics, test divertor and edge models in particular. The increased heating capabilities broaden the operational regime to include T (e)/T (i) similar to 1 and have stimulated refocussing studies from L-mode to H-mode across a range of research topics. ITER baseline parameters were reached in type-I ELMy H-modes and alternative regimes with `small' (or no) ELMs explored. Most prominently, negative triangularity was investigated in detail and confirmed as an attractive scenario with H-mode level core confinement but an L-mode edge. Emphasis was also placed on control, where an increased number of observers, actuators and control solutions became available and are now integrated into a generic control framework as will be needed in future devices. The quantity and quality of results of the 2019-20 TCV campaign are a testament to its successful integration within the European research effort alongside a vibrant domestic programme and international collaborations.

Published
2022

8. SOLPS-ITER simulations of the initiation of an X-point radiator in the ASDEX Upgrade tokamak

Author

Pan, O., https://orcid.org/0000-0003-3827-0674, Bernert, M., https://orcid.org/0000-0003-1131-0867, Lunt, T., https://orcid.org/0000-0002-7386-1456, Cavedon, M., Wischmeier, M., https://orcid.org/0000-0002-3065-027X, Stroth, U., https://orcid.org/0000-0003-1104-2233, ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, and EUROfusion MST1 Team

Published
2022

9. SOLPS-ITER simulations of an X-point radiator in the ASDEX Upgrade tokamak.

Author

Pan, O., Bernert, M., Lunt, T., Cavedon, M., Kurzan, B., Wiesen, S., Wischmeier, M., Stroth, U., and Upgrade Team, the ASDEX

Subjects
*FUSION reactor divertors, *TOKAMAKS, *RADIATORS, *PLASMA radiation, *PLASMA density, COLD regions
Abstract

The X-point radiator (XPR) is an attractive scenario that may contribute to solving the power exhaust problem in future fusion devices. The 2D transport code SOLPS-ITER was applied to reproduce the experimentally measured plasma condition with an XPR in the ASDEX Upgrade tokamak and to compare with a reduced model. Neutrals penetrating from the adjoining cold divertor region and the large connection length near the X-point play an important role in initiating an XPR. However, once such a radiator is created, it persists even if the fueling and impurity seeding rates were reduced. The redistribution of plasma density and radiation near the X-point caused by fluid drifts at the XPR was studied in the simulation. [ABSTRACT FROM AUTHOR]

Published
2023
Full Text
View/download PDF

10. Progress from ASDEX Upgrade experiments in preparing the physics basis of ITER operation and DEMO scenario development

Author

Stroth, U., primary, Aguiam, D., additional, Alessi, E., additional, Angioni, C., additional, Arden, N., additional, Parra, R. Arredondo, additional, Artigues, V., additional, Asunta, O., additional, Balden, M., additional, Bandaru, V., additional, Banon-Navarro, A., additional, Behler, K., additional, Bergmann, A., additional, Bergmann, M., additional, Bernardo, J., additional, Bernert, M., additional, Biancalani, A., additional, Bielajew, R., additional, Bilato, R., additional, Birkenmeier, G., additional, Blanken, T., additional, Bobkov, V., additional, Bock, A., additional, Body, T., additional, Bolzonella, T., additional, Bonanomi, N., additional, Bortolon, A., additional, Böswirth, B., additional, Bottereau, C., additional, Bottino, A., additional, van den Brand, H., additional, Brenzke, M., additional, Brezinsek, S., additional, Brida, D., additional, Brochard, F., additional, Bruhn, C., additional, Buchanan, J., additional, Buhler, A., additional, Burckhart, A., additional, Camenen, Y., additional, Cannas, B., additional, Megias, P. Cano, additional, Carlton, D., additional, Carr, M., additional, Carvalho, P., additional, Castaldo, C., additional, Cavedon, M., additional, Cazzaniga, C., additional, Challis, C., additional, Chankin, A., additional, Cianfarani, C., additional, Clairet, F., additional, Coda, S., additional, Coelho, R., additional, Coenen, J.W., additional, Colas, L., additional, Conway, G., additional, Costea, S., additional, Coster, D., additional, Cote, T., additional, Creely, A.J., additional, Croci, G., additional, Zabala, D.J. Cruz, additional, Cseh, G., additional, Czarnecka, A., additional, Cziegler, I., additional, D’Arcangelo, O., additional, Molin, A. Dal, additional, David, P., additional, Day, C., additional, de Baar, M., additional, de Marné, P., additional, Delogu, R., additional, Denk, S., additional, Denner, P., additional, Di Siena, A., additional, Palacios Durán, J.J. Dominguez, additional, Dunai, D., additional, Drenik, A., additional, Dreval, M., additional, Drube, R., additional, Dunne, M., additional, Duval, B.P., additional, Dux, R., additional, Eich, T., additional, Elgeti, S., additional, Encheva, A., additional, Engelhardt, K., additional, Erdös, B., additional, Erofeev, I., additional, Esposito, B., additional, Fable, E., additional, Faitsch, M., additional, Fantz, U., additional, Farnik, M., additional, Faugel, H., additional, Felici, F., additional, Ficker, O., additional, Fietz, S., additional, Figueredo, A., additional, Fischer, R., additional, Ford, O., additional, Frassinetti, L., additional, Fröschle, M., additional, Fuchert, G., additional, Fuchs, J.C., additional, Fünfgelder, H., additional, Futatani, S., additional, Galazka, K., additional, Galdon-Quiroga, J., additional, Escolà, D. Gallart, additional, Gallo, A., additional, Gao, Y., additional, Garavaglia, S., additional, Muñoz, M. Garcia, additional, Geiger, B., additional, Giannone, L., additional, Gibson, S., additional, Gil, L., additional, Giovannozzi, E., additional, Glöggler, S., additional, Gobbin, M., additional, Martin, J. Gonzalez, additional, Goodman, T., additional, Gorini, G., additional, Görler, T., additional, Gradic, D., additional, Granucci, G., additional, Gräter, A., additional, Greuner, H., additional, Griener, M., additional, Groth, M., additional, Gude, A., additional, Guimarais, L., additional, Günter, S., additional, Haas, G., additional, Hakola, A.H., additional, Ham, C., additional, Happel, T., additional, den Harder, N., additional, Harrer, G., additional, Harrison, J., additional, Hauer, V., additional, Hayward-Schneider, T., additional, Heinemann, B., additional, Hellsten, T., additional, Henderson, S., additional, Hennequin, P., additional, Herrmann, A., additional, Heyn, E., additional, Hitzler, F., additional, Hobirk, J., additional, Höfler, K., additional, Holm, J.H., additional, Hölzl, M., additional, Hopf, C., additional, Horvath, L., additional, Höschen, T., additional, Houben, A., additional, Hubbard, A., additional, Huber, A., additional, Hunger, K., additional, Igochine, V., additional, Iliasova, M., additional, Ilkei, T., additional, Björk, K. Insulander, additional, Ionita-Schrittwieser, C., additional, Ivanova-Stanik, I., additional, Jacob, W., additional, Jaksic, N., additional, Janky, F., additional, Jansen van Vuuren, A., additional, Jardin, A., additional, Jaulmes, F., additional, Jenko, F., additional, Jensen, T., additional, Joffrin, E., additional, Kallenbach, A., additional, Kálvin, S., additional, Kantor, M., additional, Kappatou, A., additional, Kardaun, O., additional, Karhunen, J., additional, Käsemann, C.-P., additional, Kasilov, S., additional, Kendl, A., additional, Kernbichler, W., additional, Khilkevitch, E., additional, Kirk, A., additional, Hansen, S. Kjer, additional, Klevarova, V., additional, Kocsis, G., additional, Koleva, M., additional, Komm, M., additional, Kong, M., additional, Krämer-Flecken, A., additional, Krieger, K., additional, Krivska, A., additional, Kudlacek, O., additional, Kurki-Suonio, T., additional, Kurzan, B., additional, Labit, B., additional, Lackner, K., additional, Laggner, F., additional, Lahtinen, A., additional, Lang, P.T., additional, Lauber, P., additional, Leuthold, N., additional, Li, L., additional, Likonen, J., additional, Linder, O., additional, Lipschultz, B., additional, Liu, Y., additional, Lohs, A., additional, Lu, Z., additional, Luda di Cortemiglia, T., additional, Luhmann, N.C., additional, Lunt, T., additional, Lyssoivan, A., additional, Maceina, T., additional, Madsen, J., additional, Magnanimo, A., additional, Maier, H., additional, Mailloux, J., additional, Maingi, R., additional, Maj, O., additional, Maljaars, E., additional, Manas, P., additional, Mancini, A., additional, Manhard, A., additional, Mantica, P., additional, Mantsinen, M., additional, Manz, P., additional, Maraschek, M., additional, Marchetto, C., additional, Marrelli, L., additional, Martin, P., additional, Martitsch, A., additional, Matos, F., additional, Mayer, M., additional, Mayoral, M.-L., additional, Mazon, D., additional, McCarthy, P.J., additional, McDermott, R., additional, Merkel, R., additional, Merle, A., additional, Meshcheriakov, D., additional, Meyer, H., additional, Milanesio, D., additional, Cabrera, P. Molina, additional, Monaco, F., additional, Muraca, M., additional, Nabais, F., additional, Naulin, V., additional, Nazikian, R., additional, Nem, R.D., additional, Nemes-Czopf, A., additional, Neu, G., additional, Neu, R., additional, Nielsen, A.H., additional, Nielsen, S.K., additional, Nishizawa, T., additional, Nocente, M., additional, Noterdaeme, J.-M., additional, Novikau, I., additional, Nowak, S., additional, Oberkofler, M., additional, Ochoukov, R., additional, Olsen, J., additional, Orain, F., additional, Palermo, F., additional, Pan, O., additional, Papp, G., additional, Perez, I. Paradela, additional, Pau, A., additional, Pautasso, G., additional, Paz-Soldan, C., additional, Petersson, P., additional, Piovesan, P., additional, Piron, C., additional, Plank, U., additional, Plaum, B., additional, Plöck, B., additional, Plyusnin, V., additional, Pokol, G., additional, Poli, E., additional, Porte, L., additional, Pütterich, T., additional, Ramisch, M., additional, Rasmussen, J., additional, Ratta, G., additional, Ratynskaia, S., additional, Raupp, G., additional, Réfy, D., additional, Reich, M., additional, Reimold, F., additional, Reiser, D., additional, Reisner, M., additional, Reiter, D., additional, Ribeiro, T., additional, Riedl, R., additional, Riesch, J., additional, Rittich, D., additional, Rodriguez, J.F. Rivero, additional, Rocchi, G., additional, Rodriguez-Fernandez, P., additional, Rodriguez-Ramos, M., additional, Rohde, V., additional, Ronchi, G., additional, Ross, A., additional, Rott, M., additional, Rubel, M., additional, Ryan, D.A., additional, Ryter, F., additional, Saarelma, S., additional, Salewski, M., additional, Salmi, A., additional, Samoylov, O., additional, Sanchez, L. Sanchis, additional, Santos, J., additional, Sauter, O., additional, Schall, G., additional, Schlüter, K., additional, Schmid, K., additional, Schmitz, O., additional, Schneider, P.A., additional, Schrittwieser, R., additional, Schubert, M., additional, Schuster, C., additional, Schwarz-Selinger, T., additional, Schweinzer, J., additional, Seliunin, E., additional, Shabbir, A., additional, Shalpegin, A., additional, Sharapov, S., additional, Sheikh, U., additional, Shevelev, A., additional, Sias, G., additional, Siccinio, M., additional, Sieglin, B., additional, Sigalov, A., additional, Silva, A., additional, Silva, C., additional, Silvagni, D., additional, Simpson, J., additional, Sipilä, S., additional, Smigelskis, E., additional, Snicker, A., additional, Solano, E., additional, Sommariva, C., additional, Sozzi, C., additional, Spizzo, G., additional, Spolaore, M., additional, Stegmeir, A., additional, Stejner, M., additional, Stober, J., additional, Strumberge, E., additional, Lopez, G. Suarez, additional, Sun, H.-J., additional, Suttrop, W., additional, Sytova, E., additional, Szepesi, T., additional, Tál, B., additional, Tala, T., additional, Tardini, G., additional, Tardocchi, M., additional, Terranova, D., additional, Teschke, M., additional, Thorén, E., additional, Tierens, W., additional, Told, D., additional, Treutterer, W., additional, Trevisan, G., additional, Trier, E., additional, Tripský, M., additional, Usoltceva, M., additional, Valisa, M., additional, Valovic, M., additional, van Zeeland, M., additional, Vannini, F., additional, Vanovac, B., additional, Varela, P., additional, Varoutis, S., additional, Vianello, N., additional, Vicente, J., additional, Verdoolaege, G., additional, Vierle, T., additional, Viezzer, E., additional, Voitsekhovitch, I., additional, von Toussaint, U., additional, Wagner, D., additional, Wang, X., additional, Weiland, M., additional, White, A.E., additional, Willensdorfer, M., additional, Wiringer, B., additional, Wischmeier, M., additional, Wolf, R., additional, Wolfrum, E., additional, Yang, Q., additional, Yu, Q., additional, Zagórski, R., additional, Zammuto, I., additional, Zehetbauer, T., additional, Zhang, W., additional, Zholobenko, W., additional, Zilker, M., additional, Zito, A., additional, Zohm, H., additional, Zoletnik, S., additional, and EUROfusion MST1 Team, the, additional

Published
2022
Full Text
View/download PDF

11. Overview of the TCV tokamak experimental programme

Author

Reimerdes, H., primary, Agostini, M., additional, Alessi, E., additional, Alberti, S., additional, Andrebe, Y., additional, Arnichand, H., additional, Balbin, J., additional, Bagnato, F., additional, Baquero-Ruiz, M., additional, Bernert, M., additional, Bin, W., additional, Blanchard, P., additional, Blanken, T.C., additional, Boedo, J.A., additional, Brida, D., additional, Brunner, S., additional, Bogar, C., additional, Bogar, O., additional, Bolzonella, T., additional, Bombarda, F., additional, Bouquey, F., additional, Bowman, C., additional, Brunetti, D., additional, Buermans, J., additional, Bufferand, H., additional, Calacci, L., additional, Camenen, Y., additional, Carli, S., additional, Carnevale, D., additional, Carpanese, F., additional, Causa, F., additional, Cavalier, J., additional, Cavedon, M., additional, Cazabonne, J.A., additional, Cerovsky, J., additional, Chandra, R., additional, Chandrarajan Jayalekshmi, A., additional, Chellaï, O., additional, Chmielewski, P., additional, Choi, D., additional, Ciraolo, G., additional, Classen, I.G.J., additional, Coda, S., additional, Colandrea, C., additional, Dal Molin, A., additional, David, P., additional, de Baar, M.R., additional, Decker, J., additional, Dekeyser, W., additional, de Oliveira, H., additional, Douai, D., additional, Dreval, M., additional, Dunne, M.G., additional, Duval, B.P., additional, Elmore, S., additional, Embreus, O., additional, Eriksson, F., additional, Faitsch, M., additional, Falchetto, G., additional, Farnik, M., additional, Fasoli, A., additional, Fedorczak, N., additional, Felici, F., additional, Février, O., additional, Ficker, O., additional, Fil, A., additional, Fontana, M., additional, Fransson, E., additional, Frassinetti, L., additional, Furno, I., additional, Gahle, D.S., additional, Galassi, D., additional, Galazka, K., additional, Galperti, C., additional, Garavaglia, S., additional, Garcia-Munoz, M., additional, Geiger, B., additional, Giacomin, M., additional, Giruzzi, G., additional, Gobbin, M., additional, Golfinopoulos, T., additional, Goodman, T., additional, Gorno, S., additional, Granucci, G., additional, Graves, J.P., additional, Griener, M., additional, Gruca, M., additional, Gyergyek, T., additional, Haelterman, R., additional, Hakola, A., additional, Han, W., additional, Happel, T., additional, Harrer, G., additional, Harrison, J.R., additional, Henderson, S., additional, Hogeweij, G.M.D., additional, Hogge, J.-P., additional, Hoppe, M., additional, Horacek, J., additional, Huang, Z., additional, Iantchenko, A., additional, Innocente, P., additional, Insulander Björk, K., additional, Ionita-Schrittweiser, C., additional, Isliker, H., additional, Jardin, A., additional, Jaspers, R.J.E., additional, Karimov, R., additional, Karpushov, A.N., additional, Kazakov, Y., additional, Komm, M., additional, Kong, M., additional, Kovacic, J., additional, Krutkin, O., additional, Kudlacek, O., additional, Kumar, U., additional, Kwiatkowski, R., additional, Labit, B., additional, Laguardia, L., additional, Lammers, J.T., additional, Laribi, E., additional, Laszynska, E., additional, Lazaros, A., additional, Linder, O., additional, Linehan, B., additional, Lipschultz, B., additional, Llobet, X., additional, Loizu, J., additional, Lunt, T., additional, Macusova, E., additional, Marandet, Y., additional, Maraschek, M., additional, Marceca, G., additional, Marchetto, C., additional, Marchioni, S., additional, Marmar, E.S., additional, Martin, Y., additional, Martinelli, L., additional, Matos, F., additional, Maurizio, R., additional, Mayoral, M.-L., additional, Mazon, D., additional, Menkovski, V., additional, Merle, A., additional, Merlo, G., additional, Meyer, H., additional, Mikszuta-Michalik, K., additional, Molina Cabrera, P.A., additional, Morales, J., additional, Moret, J.-M., additional, Moro, A., additional, Moulton, D., additional, Muhammed, H., additional, Myatra, O., additional, Mykytchuk, D., additional, Napoli, F., additional, Nem, R.D., additional, Nielsen, A.H., additional, Nocente, M., additional, Nowak, S., additional, Offeddu, N., additional, Olsen, J., additional, Orsitto, F.P., additional, Pan, O., additional, Papp, G., additional, Pau, A., additional, Perek, A., additional, Pesamosca, F., additional, Peysson, Y., additional, Pigatto, L., additional, Piron, C., additional, Poradzinski, M., additional, Porte, L., additional, Pütterich, T., additional, Rabinski, M., additional, Raj, H., additional, Rasmussen, J.J., additional, Rattá, G.A., additional, Ravensbergen, T., additional, Ricci, D., additional, Ricci, P., additional, Rispoli, N., additional, Riva, F., additional, Rivero-Rodriguez, J.F., additional, Salewski, M., additional, Sauter, O., additional, Schmidt, B.S., additional, Schrittweiser, R., additional, Sharapov, S., additional, Sheikh, U.A., additional, Sieglin, B., additional, Silva, M., additional, Smolders, A., additional, Snicker, A., additional, Sozzi, C., additional, Spolaore, M., additional, Stagni, A., additional, Stipani, L., additional, Sun, G., additional, Tala, T., additional, Tamain, P., additional, Tanaka, K., additional, Tema Biwole, A., additional, Terranova, D., additional, Terry, J.L., additional, Testa, D., additional, Theiler, C., additional, Thornton, A., additional, Thrysøe, A., additional, Torreblanca, H., additional, Tsui, C.K., additional, Vaccaro, D., additional, Vallar, M., additional, van Berkel, M., additional, Van Eester, D., additional, van Kampen, R.J.R., additional, Van Mulders, S., additional, Verhaegh, K., additional, Verhaeghe, T., additional, Vianello, N., additional, Villone, F., additional, Viezzer, E., additional, Vincent, B., additional, Voitsekhovitch, I., additional, Vu, N.M.T., additional, Walkden, N., additional, Wauters, T., additional, Weisen, H., additional, Wendler, N., additional, Wensing, M., additional, Widmer, F., additional, Wiesen, S., additional, Wischmeier, M., additional, Wijkamp, T.A., additional, Wünderlich, D., additional, Wüthrich, C., additional, Yanovskiy, V., additional, Zebrowski, J., additional, and EUROfusion MST1 Team, the, additional

Published
2022
Full Text
View/download PDF

13. Leistungsabfuhr in zukünftigen alternativen Divertorkonfigurationen für den ASDEX Upgrade Tokamak

Author

Pan, O., Stroth, Ulrich (Prof. Dr.), and Bandarenka, Aliaksandr (Prof. Dr.)

Subjects
Physik, Ingenieurwissenschaften, ddc:530, ddc:620
Abstract

The power exhaust problem is one of the most critical challenges in the future fusion reactor. In this thesis, alternative divertor configurations, which are currently discussed as a possible solution for the power exhaust problem, were studied for the future divertor in ASDEX Upgrade. The alternative configurations show a higher capacity of power and momentum removal compared to the conventional configuration and in consequence, an optimistic prediction for the power exhaust. Das Problem der Leistungsabfuhr ist eine der kritischsten Herausforderungen für zukünftigen Fusionsreaktoren. In dieser Arbeit wurden alternative Divertorkonfigurationen, die derzeit als mögliche Lösung für das Problem der Leistungsabfuhr diskutiert werden für den zukünftigen Divertor von ASDEX Upgrade untersucht. Die alternative Konfigurationen weisen im Vergleich zur herkömmlichen Konfiguration höhere Leistungs- und Impulsdissipation auf und könnte vorteilhaft für die Leistungsabfuhr sein.

Published
2020

14. Study of detachment in future ASDEX Upgrade alternative divertor configurations by means of EMC3-EIRENE

Author

Lunt, T., primary, Bernert, M., additional, Brida, D., additional, Cavedon, M., additional, David, P., additional, Faitsch, M., additional, Feng, Y., additional, Griener, M., additional, Herrmann, A., additional, Kurzan, B., additional, Pan, O., additional, Plank, U., additional, Silvagni, D., additional, Teschke, M., additional, Willensdorfer, M., additional, Wischmeier, M., additional, Wolfrum, E., additional, and Zammuto, I., additional

Published
2021
Full Text
View/download PDF

16. Near- and far scrape-off layer transport studies in detached, small-ELM ASDEX Upgrade discharges by means of EMC3-EIRENE

Author

Lunt, T, primary, Frerichs, H, additional, Bernert, M, additional, Brida, D, additional, Carralero, D, additional, Cavedon, M, additional, David, P, additional, Drenik, A, additional, Faitsch, M, additional, Feng, Y, additional, Griener, M, additional, Herrmann, A, additional, Kurzan, B, additional, Pan, O, additional, Plank, U, additional, Silvagni, D, additional, Willensdorfer, M, additional, Wischmeier, M, additional, and Wolfrum, E, additional

Published
2020
Full Text
View/download PDF

19. Evolutionary Design of Heat Exchangers in Thermal Energy Storage

Author

Pan√£o, Miguel Rosa Oliveira

Subjects
Technology & Engineering
Abstract

The efficiency and ability to control the energy exchanges in thermal energy storage systems using the sensible and latent heat thermodynamic processes depends on the best configuration in the heat exchanger’s design. In 1996, Adrian Bejan introduced the Constructal Theory, which design tools have since been explored to predict the evolution of the architecture in flow systems. This chapter reviews the fundamental knowledge developed by the application of the constructal principle to the energy flows in the design of heat exchangers of thermal energy storage systems. It introduces the Svelteness and scale analysis, as two constructal tools in the evolutionary design of engineering flow systems. It also includes the analysis on essential scales of several configurations, or energy flow architectures, toward establishing the main guidelines in the design of heat exchangers for storing thermal energy.

Published
2019

20. Overview of physics studies on ASDEX Upgrade

Author

Meyer, H., primary, Angioni, C., additional, Albert, C.G., additional, Arden, N., additional, Arredondo Parra, R., additional, Asunta, O., additional, de Baar, M., additional, Balden, M., additional, Bandaru, V., additional, Behler, K., additional, Bergmann, A., additional, Bernardo, J., additional, Bernert, M., additional, Biancalani, A., additional, Bilato, R., additional, Birkenmeier, G., additional, Blanken, T.C., additional, Bobkov, V., additional, Bock, A., additional, Bolzonella, T., additional, Bortolon, A., additional, Böswirth, B., additional, Bottereau, C., additional, Bottino, A., additional, van den Brand, H., additional, Brezinsek, S., additional, Brida, D., additional, Brochard, F., additional, Bruhn, C., additional, Buchanan, J., additional, Buhler, A., additional, Burckhart, A., additional, Camenen, Y., additional, Carlton, D., additional, Carr, M., additional, Carralero, D., additional, Castaldo, C., additional, Cavedon, M., additional, Cazzaniga, C., additional, Ceccuzzi, S., additional, Challis, C., additional, Chankin, A., additional, Chapman, S., additional, Cianfarani, C., additional, Clairet, F., additional, Coda, S., additional, Coelho, R., additional, Coenen, J.W., additional, Colas, L., additional, Conway, G.D., additional, Costea, S., additional, Coster, D.P., additional, Cote, T.B., additional, Creely, A., additional, Croci, G., additional, Cseh, G., additional, Czarnecka, A., additional, Cziegler, I., additional, D’Arcangelo, O., additional, David, P., additional, Day, C., additional, Delogu, R., additional, de Marné, P., additional, Denk, S.S., additional, Denner, P., additional, Dibon, M., additional, Di Siena, A., additional, Douai, D., additional, Drenik, A., additional, Drube, R., additional, Dunne, M., additional, Duval, B.P., additional, Dux, R., additional, Eich, T., additional, Elgeti, S., additional, Engelhardt, K., additional, Erdös, B., additional, Erofeev, I., additional, Esposito, B., additional, Fable, E., additional, Faitsch, M., additional, Fantz, U., additional, Faugel, H., additional, Faust, I., additional, Felici, F., additional, Ferreira, J., additional, Fietz, S., additional, Figuereido, A., additional, Fischer, R., additional, Ford, O., additional, Frassinetti, L., additional, Freethy, S., additional, Fröschle, M., additional, Fuchert, G., additional, Fuchs, J.C., additional, Fünfgelder, H., additional, Galazka, K., additional, Galdon-Quiroga, J., additional, Gallo, A., additional, Gao, Y., additional, Garavaglia, S., additional, Garcia-Carrasco, A., additional, Garcia-Muñoz, M., additional, Geiger, B., additional, Giannone, L., additional, Gil, L., additional, Giovannozzi, E., additional, Gleason-González, C., additional, Glöggler, S., additional, Gobbin, M., additional, Görler, T., additional, Gomez Ortiz, I., additional, Gonzalez Martin, J., additional, Goodman, T., additional, Gorini, G., additional, Gradic, D., additional, Gräter, A., additional, Granucci, G., additional, Greuner, H., additional, Griener, M., additional, Groth, M., additional, Gude, A., additional, Günter, S., additional, Guimarais, L., additional, Haas, G., additional, Hakola, A.H., additional, Ham, C., additional, Happel, T., additional, den Harder, N., additional, Harrer, G.F., additional, Harrison, J., additional, Hauer, V., additional, Hayward-Schneider, T., additional, Hegna, C.C., additional, Heinemann, B., additional, Heinzel, S., additional, Hellsten, T., additional, Henderson, S., additional, Hennequin, P., additional, Herrmann, A., additional, Heyn, M.F., additional, Heyn, E., additional, Hitzler, F., additional, Hobirk, J., additional, Höfler, K., additional, Hölzl, M., additional, Höschen, T., additional, Holm, J.H., additional, Hopf, C., additional, Hornsby, W.A., additional, Horvath, L., additional, Houben, A., additional, Huber, A., additional, Igochine, V., additional, Ilkei, T., additional, Ivanova-Stanik, I., additional, Jacob, W., additional, Jacobsen, A.S., additional, Janky, F., additional, Jansen van Vuuren, A., additional, Jardin, A., additional, Jaulmes, F., additional, Jenko, F., additional, Jensen, T., additional, Joffrin, E., additional, Käsemann, C.-P., additional, Kallenbach, A., additional, Kálvin, S., additional, Kantor, M., additional, Kappatou, A., additional, Kardaun, O., additional, Karhunen, J., additional, Kasilov, S., additional, Kazakov, Y., additional, Kernbichler, W., additional, Kirk, A., additional, Kjer Hansen, S., additional, Klevarova, V., additional, Kocsis, G., additional, Köhn, A., additional, Koubiti, M., additional, Krieger, K., additional, Krivska, A., additional, Krämer-Flecken, A., additional, Kudlacek, O., additional, Kurki-Suonio, T., additional, Kurzan, B., additional, Labit, B., additional, Lackner, K., additional, Laggner, F., additional, Lang, P.T., additional, Lauber, P., additional, Lebschy, A., additional, Leuthold, N., additional, Li, M., additional, Linder, O., additional, Lipschultz, B., additional, Liu, F., additional, Liu, Y., additional, Lohs, A., additional, Lu, Z., additional, Luda di Cortemiglia, T., additional, Luhmann, N.C., additional, Lunsford, R., additional, Lunt, T., additional, Lyssoivan, A., additional, Maceina, T., additional, Madsen, J., additional, Maggiora, R., additional, Maier, H., additional, Maj, O., additional, Mailloux, J., additional, Maingi, R., additional, Maljaars, E., additional, Manas, P., additional, Mancini, A., additional, Manhard, A., additional, Manso, M.-E., additional, Mantica, P., additional, Mantsinen, M., additional, Manz, P., additional, Maraschek, M., additional, Martens, C., additional, Martin, P., additional, Marrelli, L., additional, Martitsch, A., additional, Mayer, M., additional, Mazon, D., additional, McCarthy, P.J., additional, McDermott, R., additional, Meister, H., additional, Medvedeva, A., additional, Merkel, R., additional, Merle, A., additional, Mertens, V., additional, Meshcheriakov, D., additional, Meyer, O., additional, Miettunen, J., additional, Milanesio, D., additional, Mink, F., additional, Mlynek, A., additional, Monaco, F., additional, Moon, C., additional, Nabais, F., additional, Nemes-Czopf, A., additional, Neu, G., additional, Neu, R., additional, Nielsen, A.H., additional, Nielsen, S.K., additional, Nikolaeva, V., additional, Nocente, M., additional, Noterdaeme, J.-M., additional, Novikau, I., additional, Nowak, S., additional, Oberkofler, M., additional, Oberparleiter, M., additional, Ochoukov, R., additional, Odstrcil, T., additional, Olsen, J., additional, Orain, F., additional, Palermo, F., additional, Pan, O., additional, Papp, G., additional, Paradela Perez, I., additional, Pau, A., additional, Pautasso, G., additional, Penzel, F., additional, Petersson, P., additional, Pinzón Acosta, J., additional, Piovesan, P., additional, Piron, C., additional, Pitts, R., additional, Plank, U., additional, Plaum, B., additional, Ploeckl, B., additional, Plyusnin, V., additional, Pokol, G., additional, Poli, E., additional, Porte, L., additional, Potzel, S., additional, Prisiazhniuk, D., additional, Pütterich, T., additional, Ramisch, M., additional, Rasmussen, J., additional, Rattá, G.A., additional, Ratynskaia, S., additional, Raupp, G., additional, Ravera, G.L., additional, Réfy, D., additional, Reich, M., additional, Reimold, F., additional, Reiser, D., additional, Ribeiro, T., additional, Riesch, J., additional, Riedl, R., additional, Rittich, D., additional, Rivero-Rodriguez, J.F., additional, Rocchi, G., additional, Rodriguez-Ramos, M., additional, Rohde, V., additional, Ross, A., additional, Rott, M., additional, Rubel, M., additional, Ryan, D., additional, Ryter, F., additional, Saarelma, S., additional, Salewski, M., additional, Salmi, A., additional, Sanchis-Sanchez, L., additional, Santos, J., additional, Sauter, O., additional, Scarabosio, A., additional, Schall, G., additional, Schmid, K., additional, Schmitz, O., additional, Schneider, P.A., additional, Schrittwieser, R., additional, Schubert, M., additional, Schwarz-Selinger, T., additional, Schweinzer, J., additional, Scott, B., additional, Sehmer, T., additional, Seliunin, E., additional, Sertoli, M., additional, Shabbir, A., additional, Shalpegin, A., additional, Shao, L., additional, Sharapov, S., additional, Sias, G., additional, Siccinio, M., additional, Sieglin, B., additional, Sigalov, A., additional, Silva, A., additional, Silva, C., additional, Silvagni, D., additional, Simon, P., additional, Simpson, J., additional, Smigelskis, E., additional, Snicker, A., additional, Sommariva, C., additional, Sozzi, C., additional, Spolaore, M., additional, Stegmeir, A., additional, Stejner, M., additional, Stober, J., additional, Stroth, U., additional, Strumberger, E., additional, Suarez, G., additional, Sun, H.-J., additional, Suttrop, W., additional, Sytova, E., additional, Szepesi, T., additional, Tál, B., additional, Tala, T., additional, Tardini, G., additional, Tardocchi, M., additional, Teschke, M., additional, Terranova, D., additional, Tierens, W., additional, Thorén, E., additional, Told, D., additional, Tolias, P., additional, Tudisco, O., additional, Treutterer, W., additional, Trier, E., additional, Tripský, M., additional, Valisa, M., additional, Valovic, M., additional, Vanovac, B., additional, van Vugt, D., additional, Varoutis, S., additional, Verdoolaege, G., additional, Vianello, N., additional, Vicente, J., additional, Vierle, T., additional, Viezzer, E., additional, von Toussaint, U., additional, Wagner, D., additional, Wang, N., additional, Wang, X., additional, Weiland, M., additional, White, A.E., additional, Wiesen, S., additional, Willensdorfer, M., additional, Wiringer, B., additional, Wischmeier, M., additional, Wolf, R., additional, Wolfrum, E., additional, Xiang, L., additional, Yang, Q., additional, Yang, Z., additional, Yu, Q., additional, Zagórski, R., additional, Zammuto, I., additional, Zhang, W., additional, van Zeeland, M., additional, Zehetbauer, T., additional, Zilker, M., additional, Zoletnik, S., additional, and Zohm, H., additional

Published
2019
Full Text
View/download PDF

23. The diffusion limit of ballistic transport in the scrape-off layer.

Author

Manz, P., Hufnagel, C., Zito, A., Carralero, D., Griener, M., Lunt, T., Pan, O., Passoni, M., Tal, B., Wischmeier, M., and Wolfrum, E.

Subjects
BALLISTIC conduction, DIFFUSION, PLASMA confinement, RANDOM walks, DIFFUSION coefficients, TELEGRAPH & telegraphy, AMMUNITION
Abstract

At least the far scrape-off layer of magnetically confined fusion plasmas transport is intermittent and non-diffusive as observed by the appearance of plasma filaments. Transport codes using effective diffusion coefficients are still the main workhorse investigating the scrape-off layer and divertor regions. An effective perpendicular diffusion coefficient for intermittent filamentary dominated perpendicular transport in the scrape-off layer is motivated by the telegraph equation, describing an exponentially decaying correlated random walk. On short time scales, the telegraph equation describes the ballistic transport of filamentary structures with a typical velocity ub and correlation time τ. In stationary conditions, the corresponding diffusion coefficient is given by u b 2 τ. Since ub and τ can be determined experimentally, it is proposed to use u b 2 τ as an input for modeling or for interpretation of perpendicular transport in the far scrape-off layer. [ABSTRACT FROM AUTHOR]

Published
2020
Full Text
View/download PDF

26. Efficacy of garbanzo and soybean flour in suppression of aberrant crypt foci in the colons of CF-1 mice

Author

Murillo, G., Choi, J. K., Pan, O., Constantinou, Andreas I., Mehta, R. G., and Constantinou, Andreas I. [0000-0003-0365-1821]

Subjects
natural product, aberrant crypt focus, precancer, Garbanzo beans, phytochemical, Soybean flour, Chemoprevention, intestine crypt, animal tissue, Mice, Animals, controlled study, chemical compound, soybean, mouse, ACF, nonhuman, flour, article, food and beverages, legume, Cicer, unclassified drug, Colon cancer, female, CF 1 mouse, priority journal, azoxymethane, diet supplementation, CF-1 mice, Colonic Neoplasms, Carcinogens, mouse strain, Soybeans, Precancerous Conditions, garbanzo flour, Phytotherapy
Abstract

Background: Epidemiological studies have reported a low incidence of colon cancer in countries with high legume consumption. Moreover, experimental studies have found that legumes, such as soybeans and pinto beans, have anticancer properties. While garbanzo beans are a rich source of various phytochemicals, they have not been well studied. In the present study, the azoxymethane (AOM)-induced aberrant crypt foci (ACF) in CF-1 mice was utilized as a model to assess and compare the effects of garbanzo flour to that of soy flour. Materials and Methods: Twenty, 5-week-old CF-1 mice were divided into four groups of 5 animals each: 10% garbanzo, 10% soy, 10% mixed (soy and garbanzo flours), and control (rodent chow). Animals received subcutaneous injections of AOM (10-mg/kg B.W.) once a week for two weeks to induce ACF. At week ten, the animals were sacrificed and the colons were scored. Results: There was a 64% (pCited By :22

Published
2004

31. SIMULATION OF TRANSPORT POLICY ALTERNATIVES FOR COLOMBIA.

Author

Roberts, Pan. O. and Kresge, David T.

Subjects
ECONOMIC development, TRANSPORTATION policy, COLOMBIAN economy, TRANSPORTATION, STRATEGIC planning, ECONOMETRIC models, MACROECONOMICS, ECONOMIC policy, PRICING
Abstract

Economic development, like most other human endeavors, appears to be strongly influenced by transportation in the U.S. as of May 1968. Planning for transportation must therefore be closely integrated with general development planning in order to be effective. Over the past three years, the Transport Research Program in the John F. Kennedy School of Government at Harvard has developed a macroeconomic and transport model to explore the interface between the economy of an underdeveloped nation and its transportation system. The macroeconomic portion of the model produces annual projections of regional demands, production levels, and incomes. The transport sector determines market areas, distribution and routing of these commodity flows, and assigns them to the links of a network representing the individual transport facilities existing or proposed for the country or region under study. The operating characteristic of the transport system are determined, and objective measures of performance are obtained. These measures are then fed back to the macroeconomic portion of the model so that the interaction can be accounted for in subsequent time periods. This approach attempts to combine macroeconomic modeling with a detailed simulation of the transport system over multiple time periods so that alternative development strategies, pricing policies, and investment plans may be compared and evaluated.

Published
1968

33. The C-terminal domain of matrilin-2 assembles into a three-stranded alpha-helical coiled coil.

Author

Pan, O H and Beck, K

Abstract

Matrilin-2 is a member of von Willebrand factor A containing extracellular matrix proteins in which the cDNA-derived sequence shows similar domain organization to cartilage matrix protein/matrilin-1, but information on the protein structure is limited. Here we studied the oligomerization potential of a synthetic peptide NH2-ENLILFQNVANEEVRKLTQRLEEMTQRMEALENRLKYR-COOH corresponding to the C-terminal sequence of mouse matrilin-2. The central portion of this sequence shows a periodicity of hydrophobic residues occupying positions a and d of a heptad pattern (abcdefg)n, which is characteristic for alpha-helical coiled-coil proteins. Circular dichroism spectroscopy revealed a high alpha-helical content, and the shape of the spectra is indicative for a coiled-coil conformation. Chemical cross-linking and size exclusion chromatography suggest a homotrimeric configuration. Thermal denaturation in benign buffer shows a single cooperative transition with DeltaH0 = -375 kJ/mol. Melting temperatures Tm varied from 38 to 51 degreesC within a concentration range of 10 to 85 microM, which is about 35 degreesC lower than determined for a peptide corresponding to the C-terminal domain of matrilin-1. The data suggest that despite the low sequence identity within this region, matrilin-2 will form a homotrimer as matrilin-1 does.

Published
1998

35. OVERVIEW OF PHYSICS STUDIES ON ASDEX UPGRADE

Author

Neville C. Luhmann, J. Mailloux, A. Kappatou, Yann Camenen, R. Arredondo Parra, P. Petersson, G. F. Harrer, I. Gomez Ortiz, E. Giovannozzi, S. S. Henderson, C. Sommariva, Thomas Schwarz-Selinger, G. Fuchert, Christopher G. Albert, P. Piovesan, A. Herrmann, C. Piron, Robert Lunsford, J. Hobirk, F. Clairet, L. Xiang, Carlo Cazzaniga, A. Burckhart, B. Kurzan, Bernhard Ploeckl, G. Kocsis, A. Mancini, Benoit Labit, M. Reich, N. den Harder, Faa Federico Felici, M. Oberparleiter, Tamás Szepesi, Sibylle Günter, K. Behler, R. Merkel, Ocleto D'Arcangelo, G. Haas, Alessandro Bortolon, T. B. Cote, E. Trier, P. Simon, A. Gude, Daniele Milanesio, Winfried Kernbichler, Dorothea Gradic, M. Rodriguez-Ramos, G.A. Rattá, G. Croci, O. Tudisco, E. Heyn, M. Groth, J. Gonzalez Martin, Olivier Sauter, Irena Ivanova-Stanik, Massimo Nocente, J. R. Harrison, Martin Heyn, C. Bruhn, C. Ham, L. Shao, M. Schubert, F. Brochard, Yu Gao, Bernd Heinemann, Sandra C. Chapman, Armin Manhard, S. S. Denk, A. Jardin, D. P. Coster, G. Schall, L. Horvath, Alexander Creely, Roman Schrittwieser, Patrick J. McCarthy, C. Castaldo, B. Wiringer, M. J. Mantsinen, Till Höschen, Ph. Lauber, V. Mertens, Anders Nielsen, G. Suarez, M. E. Manso, M. Dibon, S. Wiesen, Mirko Salewski, C. D. Challis, J. Schweinzer, D. Douai, Lorenzo Frassinetti, R. C. Wolf, Mirko Ramisch, P. de Marne, Yueqiang Liu, H. van den Brand, S. Nowak, E. Joffrin, M. Teschke, Karl Schmid, D. Silvagni, L. Giannone, D. I. Refy, E. Wolfrum, M. Sertoli, Chanho Moon, O. J. W. F. Kardaun, A. Ross, S. Elgeti, A. Shalpegin, G. D. Conway, A. Sigalov, Alberto Bottino, Benedikt Geiger, M. Willensdorfer, D. C. van Vugt, Mark Maraschek, W. Zhang, M. Oberkofler, M. Griener, Stylianos Varoutis, Bill Scott, F. Monaco, W. Suttrop, Helmut Faugel, Christian Hopf, J. Vicente, Gerhard Raupp, S. Fietz, Omar Maj, D. Terranova, Q. Yu, E. Seliunin, L. Gil, K. Lackner, I. Novikau, S. Heinzel, G. Birkenmeier, O. Linder, I. Zammuto, H. Fünfgelder, Alessandro Biancalani, D. Prisiazhniuk, Analiza M. Silva, Volker Hauer, Ulrich Stroth, M. Faitsch, Toke Koldborg Jensen, S. Brezinsek, S. Garavaglia, V. Nikolaeva, C. Angioni, T. Maceina, Antti Snicker, O. Schmitz, T. Vierle, A. Scarabosio, D. Carlton, F. Penzel, M. Tardocchi, Riccardo Maggiora, V. Plyusnin, A. Bergmann, A. Bock, G. Rocchi, Andreas Frank Martitsch, J. W. Coenen, I. Erofeev, Pierre Manas, J. Stober, O. Meyer, M. A. Van Zeeland, A. S. Jacobsen, H. Meister, Jens Madsen, E. Smigelskis, A. Lohs, T. Happel, A. Gallo, F. Ryter, P. A. Schneider, A. Kallenbach, Alf Köhn, C. Bottereau, I. Paradela Perez, N. Arden, M. Koubiti, Gergely Papp, Burkhard Plaum, Jorge Ferreira, P. Denner, H. Greuner, Daniel Told, M. Weiland, T. Hayward-Schneider, B. Sieglin, A. Buhler, B. Böswirth, A. Krämer-Flecken, F. Jaulmes, J. Galdon-Quiroga, M. Balden, J. Pinzón Acosta, C. Sozzi, T. Bolzonella, G. Neu, Simon Freethy, T. Sehmer, K. Höfler, T. T. Ribeiro, F. Mink, Ursel Fantz, Q. Yang, Jeppe Olsen, M. Wischmeier, P. Mantica, Timothy Goodman, R. Delogu, T. Tala, Panagiotis Tolias, A. Houben, G. Tardini, A. Kirk, T. Odstrcil, R. Fischer, J. Juul Rasmussen, D. Carralero, H. F. Meyer, P. Martin, J. Miettunen, E. Maljaars, Matthew Carr, Z. Yang, G. Pautasso, B. P. Duval, E. Sytova, Stefano Coda, D. Meshcheriakov, Morten Stejner, S. Zoletnik, Thomas Zehetbauer, M. Li, F. Liu, R. Neu, A. Drenik, P. Manz, E. Fable, Otto Asunta, Zhixin Lu, S. Kálvin, Bruce Lipschultz, Vinodh Bandaru, A. Di Siena, Mattia Siccinio, S. Costea, Frank Jenko, Peter Lang, V. Rohde, Manfred Zilker, F. Nabais, H. J. Sun, Chris Hegna, A. Krivska, M. Rott, S. E. Sharapov, Antoine Merle, J. Bernardo, K. Engelhardt, M. Garcia-Munoz, M. Kantor, M. Hölzl, J. M. Santos, L. Guimarais, A. Figuereido, Carlos B. da Silva, Ch. Day, P. David, U. von Toussaint, T. C. Blanken, D. A. Ryan, F. Palermo, Silvio Ceccuzzi, J.-M. Noterdaeme, M. Gobbin, A. Jansen van Vuuren, C.-P. Kasemann, D. Rittich, Wouter Tierens, Taina Kurki-Suonio, C. Martens, R. Riedl, Antti Hakola, A. Czarnecka, F. Hitzler, M. Spolaore, M. Tripský, D. Brida, A. V. Chankin, Alessandro Pau, T. Ilkei, K. Krieger, Emanuele Poli, Florian Laggner, J. F. Rivero-Rodriguez, Wolfgang Jacob, Nengchao Wang, Anne White, S. Kjer Hansen, Stefan Kragh Nielsen, M. Fröschle, R. Bilato, O. Kudlacek, Tobias Görler, A. Stegmeir, Ari Salmi, L. Colas, A. Mlynek, Istvan Cziegler, V. Bobkov, James Buchanan, A. Gräter, T. Luda di Cortemiglia, R. Drube, John Hammer Holm, Giuliana Sias, K. Galazka, Giuseppe Gorini, V. Igochine, B. Vanovac, O. P. Ford, A. Garcia-Carrasco, R. M. McDermott, B. Tal, A. Lebschy, M. Cavedon, Julia Fuchs, E. Viezzer, R. Dux, R.A. Pitts, Svetlana V. Ratynskaia, Aqsa Shabbir, Sergei Kasilov, M. Bernert, S. Saarelma, Gergö Pokol, F. Reimold, Geert Verdoolaege, M. Mayer, Marek Rubel, L. Sanchis-Sanchez, R. Maingi, William Hornsby, U. Plank, C. Cianfarani, N. Vianello, A. Huber, Gustavo Granucci, Didier Mazon, S. Glöggler, J. Simpson, I. Faust, G. L. Ravera, Laurie Porte, Johann Riesch, F. Janky, A Lyssoivan, T. Pütterich, F. Orain, M. Valisa, B. Esposito, C. Gleason-González, Juha Karhunen, M. Valovic, H. Maier, Gábor Cseh, A. Nemes-Czopf, E. Thoren, O. Pan, T. Eich, R. Coelho, M.R. de Baar, E. Strumberger, T. Hellsten, Lionello Marrelli, Boglarka Erdos, Pascale Hennequin, R. Ochoukov, H. Zohm, D. Wagner, Yevgen O. Kazakov, A. Medvedeva, M. G. Dunne, W. Treutterer, N. Leuthold, R. Zagórski, S. Potzel, V. Klevarova, Dirk Reiser, X. Wang, T. Lunt, Meyer, H, Angioni, C, Albert, C, Arden, N, Arredondo Parra, R, Asunta, O, De Baar, M, Balden, M, Bandaru, V, Behler, K, Bergmann, A, Bernardo, J, Bernert, M, Biancalani, A, Bilato, R, Birkenmeier, G, Blanken, T, Bobkov, V, Bock, A, Bolzonella, T, Bortolon, A, Boswirth, B, Bottereau, C, Bottino, A, Van Den Brand, H, Brezinsek, S, Brida, D, Brochard, F, Bruhn, C, Buchanan, J, Buhler, A, Burckhart, A, Camenen, Y, Carlton, D, Carr, M, Carralero, D, Castaldo, C, Cavedon, M, Cazzaniga, C, Ceccuzzi, S, Challis, C, Chankin, A, Chapman, S, Cianfarani, C, Clairet, F, Coda, S, Coelho, R, Coenen, J, Colas, L, Conway, G, Costea, S, Coster, D, Cote, T, Creely, A, Croci, G, Cseh, G, Czarnecka, A, Cziegler, I, D'Arcangelo, O, David, P, Day, C, Delogu, R, De Marne, P, Denk, S, Denner, P, Dibon, M, Di Siena, A, Douai, D, Drenik, A, Drube, R, Dunne, M, Duval, B, Dux, R, Eich, T, Elgeti, S, Engelhardt, K, Erdos, B, Erofeev, I, Esposito, B, Fable, E, Faitsch, M, Fantz, U, Faugel, H, Faust, I, Felici, F, Ferreira, J, Fietz, S, Figuereido, A, Fischer, R, Ford, O, Frassinetti, L, Freethy, S, Froschle, M, Fuchert, G, Fuchs, J, Funfgelder, H, Galazka, K, Galdon-Quiroga, J, Gallo, A, Gao, Y, Garavaglia, S, Garcia-Carrasco, A, Garcia-Munoz, M, Geiger, B, Giannone, L, Gil, L, Giovannozzi, E, Gleason-Gonzalez, C, Gloggler, S, Gobbin, M, Gorler, T, Gomez Ortiz, I, Gonzalez Martin, J, Goodman, T, Gorini, G, Gradic, D, Grater, A, Granucci, G, Greuner, H, Griener, M, Groth, M, Gude, A, Gunter, S, Guimarais, L, Haas, G, Hakola, A, Ham, C, Happel, T, Den Harder, N, Harrer, G, Harrison, J, Hauer, V, Hayward-Schneider, T, Hegna, C, Heinemann, B, Heinzel, S, Hellsten, T, Henderson, S, Hennequin, P, Herrmann, A, Heyn, M, Heyn, E, Hitzler, F, Hobirk, J, Hofler, K, Holzl, M, Hoschen, T, Holm, J, Hopf, C, Hornsby, W, Horvath, L, Houben, A, Huber, A, Igochine, V, Ilkei, T, Ivanova-Stanik, I, Jacob, W, Jacobsen, A, Janky, F, Jansen Van Vuuren, A, Jardin, A, Jaulmes, F, Jenko, F, Jensen, T, Joffrin, E, Kasemann, C, Kallenbach, A, Kalvin, S, Kantor, M, Kappatou, A, Kardaun, O, Karhunen, J, Kasilov, S, Kazakov, Y, Kernbichler, W, Kirk, A, Kjer Hansen, S, Klevarova, V, Kocsis, G, Kohn, A, Koubiti, M, Krieger, K, Krivska, A, Kramer-Flecken, A, Kudlacek, O, Kurki-Suonio, T, Kurzan, B, Labit, B, Lackner, K, Laggner, F, Lang, P, Lauber, P, Lebschy, A, Leuthold, N, Li, M, Linder, O, Lipschultz, B, Liu, F, Liu, Y, Lohs, A, Lu, Z, Luda Di Cortemiglia, T, Luhmann, N, Lunsford, R, Lunt, T, Lyssoivan, A, Maceina, T, Madsen, J, Maggiora, R, Maier, H, Maj, O, Mailloux, J, Maingi, R, Maljaars, E, Manas, P, Mancini, A, Manhard, A, Manso, M, Mantica, P, Mantsinen, M, Manz, P, Maraschek, M, Martens, C, Martin, P, Marrelli, L, Martitsch, A, Mayer, M, Mazon, D, Mccarthy, P, Mcdermott, R, Meister, H, Medvedeva, A, Merkel, R, Merle, A, Mertens, V, Meshcheriakov, D, Meyer, O, Miettunen, J, Milanesio, D, Mink, F, Mlynek, A, Monaco, F, Moon, C, Nabais, F, Nemes-Czopf, A, Neu, G, Neu, R, Nielsen, A, Nielsen, S, Nikolaeva, V, Nocente, M, Noterdaeme, J, Novikau, I, Nowak, S, Oberkofler, M, Oberparleiter, M, Ochoukov, R, Odstrcil, T, Olsen, J, Orain, F, Palermo, F, Pan, O, Papp, G, Paradela Perez, I, Pau, A, Pautasso, G, Penzel, F, Petersson, P, Pinzon Acosta, J, Piovesan, P, Piron, C, Pitts, R, Plank, U, Plaum, B, Ploeckl, B, Plyusnin, V, Pokol, G, Poli, E, Porte, L, Potzel, S, Prisiazhniuk, D, Putterich, T, Ramisch, M, Rasmussen, J, Ratta, G, Ratynskaia, S, Raupp, G, Ravera, G, Refy, D, Reich, M, Reimold, F, Reiser, D, Ribeiro, T, Riesch, J, Riedl, R, Rittich, D, Rivero-Rodriguez, J, Rocchi, G, Rodriguez-Ramos, M, Rohde, V, Ross, A, Rott, M, Rubel, M, Ryan, D, Ryter, F, Saarelma, S, Salewski, M, Salmi, A, Sanchis-Sanchez, L, Santos, J, Sauter, O, Scarabosio, A, Schall, G, Schmid, K, Schmitz, O, Schneider, P, Schrittwieser, R, Schubert, M, Schwarz-Selinger, T, Schweinzer, J, Scott, B, Sehmer, T, Seliunin, E, Sertoli, M, Shabbir, A, Shalpegin, A, Shao, L, Sharapov, S, Sias, G, Siccinio, M, Sieglin, B, Sigalov, A, Silva, A, Silva, C, Silvagni, D, Simon, P, Simpson, J, Smigelskis, E, Snicker, A, Sommariva, C, Sozzi, C, Spolaore, M, Stegmeir, A, Stejner, M, Stober, J, Stroth, U, Strumberger, E, Suarez, G, Sun, H, Suttrop, W, Sytova, E, Szepesi, T, Tal, B, Tala, T, Tardini, G, Tardocchi, M, Teschke, M, Terranova, D, Tierens, W, Thoren, E, Told, D, Tolias, P, Tudisco, O, Treutterer, W, Trier, E, Tripsky, M, Valisa, M, Valovic, M, Vanovac, B, Van Vugt, D, Varoutis, S, Verdoolaege, G, Vianello, N, Vicente, J, Vierle, T, Viezzer, E, Von Toussaint, U, Wagner, D, Wang, N, Wang, X, Weiland, M, White, A, Wiesen, S, Willensdorfer, M, Wiringer, B, Wischmeier, M, Wolf, R, Wolfrum, E, Xiang, L, Yang, Q, Yang, Z, Yu, Q, Zagorski, R, Zammuto, I, Zhang, W, Van Zeeland, M, Zehetbauer, T, Zilker, M, Zoletnik, S, Zohm, H, Meyer, H., Universidad de Sevilla, Departamento de Física Atómica, Molecular y Nuclear, Universidad de Sevilla. RNM138: Física Nuclear Aplicada, Universidad de Sevilla. TEP111: Ingeniería Mecánica, CEA Cadarache, Commissariat à l'énergie atomique et aux énergies alternatives (CEA), Institut Jean Lamour (IJL), Institut de Chimie du CNRS (INC)-Université de Lorraine (UL)-Centre National de la Recherche Scientifique (CNRS), Physique des interactions ioniques et moléculaires (PIIM), Aix Marseille Université (AMU)-Centre National de la Recherche Scientifique (CNRS), Laboratoire de Physique des Plasmas (LPP), Observatoire de Paris, Université Paris sciences et lettres (PSL)-Université Paris sciences et lettres (PSL)-École polytechnique (X)-Sorbonne Université (SU)-Université Paris-Saclay-Centre National de la Recherche Scientifique (CNRS), Culham Science Centre, Max-Planck-Institut für Plasmaphysik, Department of Applied Physics, Dutch Institute for Fundamental Energy Research, University of Lisbon, Eindhoven University of Technology, National Research Council of Italy, Princeton University, CEA, Forschungszentrum Jülich, Université de Lorraine, CNRS, Agenzia nazionale per le nuove tecnologie, l'energia e lo sviluppo economico sostenibile, University of Warwick, Swiss Federal Institute of Technology Lausanne, University of Innsbruck, University of Wisconsin-Madison, Massachusetts Institute of Technology, Hungarian Academy of Sciences, Soltan Institute for Nuclear Studies, University of York, Karlsruhe Institute of Technology, KTH Royal Institute of Technology, University of Seville, University of Milan - Bicocca, Fusion and Plasma Physics, VTT Technical Research Centre of Finland, Vienna University of Technology, Max-Planck Computing and Data Facility, General Atomics, Université Paris-Saclay, Graz University of Technology, Institut für Grenzflachenverfahrenstechnik und Plasmatechnologie, Danmarks Tekniske Universitet, Budapest University of Technology and Economics, Polish Academy of Sciences, Royal Military Academy, Ghent University, ITER Organization, University of California Davis, Polytechnic University of Turin, Barcelona Supercomputing Center, University College Cork, Chalmers University of Technology, University of Cagliari, ITER, CIEMAT, CAS - Institute of Plasma Physics, Max Planck Institute for Plasma Physics, Aalto-yliopisto, Aalto University, Angioni, C., Albert, C. G., Arden, N., Arredondo Parra, R., Asunta, O., De Baar, M., Balden, M., Bandaru, V., Behler, K., Bergmann, A., Bernardo, J., Bernert, M., Biancalani, A., Bilato, R., Birkenmeier, G., Blanken, T. C., Bobkov, V., Bock, A., Bolzonella, T., Bortolon, A., Boswirth, B., Bottereau, C., Bottino, A., Van Den Brand, H., Brezinsek, S., Brida, D., Brochard, F., Bruhn, C., Buchanan, J., Buhler, A., Burckhart, A., Camenen, Y., Carlton, D., Carr, M., Carralero, D., Castaldo, C., Cavedon, M., Cazzaniga, C., Ceccuzzi, S., Challis, C., Chankin, A., Chapman, S., Cianfarani, C., Clairet, F., Coda, S., Coelho, R., Coenen, J. W., Colas, L., Conway, G. D., Costea, S., Coster, D. P., Cote, T. B., Creely, A., Croci, G., Cseh, G., Czarnecka, A., Cziegler, I., D'Arcangelo, O., David, P., Day, C., Delogu, R., De Marne, P., Denk, S. S., Denner, P., Dibon, M., Di Siena, A., Douai, D., Drenik, A., Drube, R., Dunne, M., Duval, B. P., Dux, R., Eich, T., Elgeti, S., Engelhardt, K., Erdos, B., Erofeev, I., Esposito, B., Fable, E., Faitsch, M., Fantz, U., Faugel, H., Faust, I., Felici, F., Ferreira, J., Fietz, S., Figuereido, A., Fischer, R., Ford, O., Frassinetti, L., Freethy, S., Froschle, M., Fuchert, G., Fuchs, J. C., Funfgelder, H., Galazka, K., Galdon-Quiroga, J., Gallo, A., Gao, Y., Garavaglia, S., Garcia-Carrasco, A., Garcia-Munoz, M., Geiger, B., Giannone, L., Gil, L., Giovannozzi, E., Gleason-Gonzalez, C., Gloggler, S., Gobbin, M., Gorler, T., Gomez Ortiz, I., Gonzalez Martin, J., Goodman, T., Gorini, G., Gradic, D., Grater, A., Granucci, G., Greuner, H., Griener, M., Groth, M., Gude, A., Gunter, S., Guimarais, L., Haas, G., Hakola, A. H., Ham, C., Happel, T., Den Harder, N., Harrer, G. F., Harrison, J., Hauer, V., Hayward-Schneider, T., Hegna, C. C., Heinemann, B., Heinzel, S., Hellsten, T., Henderson, S., Hennequin, P., Herrmann, A., Heyn, M. F., Heyn, E., Hitzler, F., Hobirk, J., Hofler, K., Holzl, M., Hoschen, T., Holm, J. H., Hopf, C., Hornsby, W. A., Horvath, L., Houben, A., Huber, A., Igochine, V., Ilkei, T., Ivanova-Stanik, I., Jacob, W., Jacobsen, A. S., Janky, F., Jansen Van Vuuren, A., Jardin, A., Jaulmes, F., Jenko, F., Jensen, T., Joffrin, E., Kasemann, C. -P., Kallenbach, A., Kalvin, S., Kantor, M., Kappatou, A., Kardaun, O., Karhunen, J., Kasilov, S., Kazakov, Y., Kernbichler, W., Kirk, A., Kjer Hansen, S., Klevarova, V., Kocsis, G., Kohn, A., Koubiti, M., Krieger, K., Krivska, A., Kramer-Flecken, A., Kudlacek, O., Kurki-Suonio, T., Kurzan, B., Labit, B., Lackner, K., Laggner, F., Lang, P. T., Lauber, P., Lebschy, A., Leuthold, N., Li, M., Linder, O., Lipschultz, B., Liu, F., Liu, Y., Lohs, A., Lu, Z., Luda Di Cortemiglia, T., Luhmann, N. C., Lunsford, R., Lunt, T., Lyssoivan, A., Maceina, T., Madsen, J., Maggiora, R., Maier, H., Maj, O., Mailloux, J., Maingi, R., Maljaars, E., Manas, P., Mancini, A., Manhard, A., Manso, M. -E., Mantica, P., Mantsinen, M., Manz, P., Maraschek, M., Martens, C., Martin, P., Marrelli, L., Martitsch, A., Mayer, M., Mazon, D., Mccarthy, P. J., Mcdermott, R., Meister, H., Medvedeva, A., Merkel, R., Merle, A., Mertens, V., Meshcheriakov, D., Meyer, O., Miettunen, J., Milanesio, D., Mink, F., Mlynek, A., Monaco, F., Moon, C., Nabais, F., Nemes-Czopf, A., Neu, G., Neu, R., Nielsen, A. H., Nielsen, S. K., Nikolaeva, V., Nocente, M., Noterdaeme, J. -M., Novikau, I., Nowak, S., Oberkofler, M., Oberparleiter, M., Ochoukov, R., Odstrcil, T., Olsen, J., Orain, F., Palermo, F., Pan, O., Papp, G., Paradela Perez, I., Pau, A., Pautasso, G., Penzel, F., Petersson, P., Pinzon Acosta, J., Piovesan, P., Piron, C., Pitts, R., Plank, U., Plaum, B., Ploeckl, B., Plyusnin, V., Pokol, G., Poli, E., Porte, L., Potzel, S., Prisiazhniuk, D., Putterich, T., Ramisch, M., Rasmussen, J., Ratta, G. A., Ratynskaia, S., Raupp, G., Ravera, G. L., Refy, D., Reich, M., Reimold, F., Reiser, D., Ribeiro, T., Riesch, J., Riedl, R., Rittich, D., Rivero-Rodriguez, J. F., Rocchi, G., Rodriguez-Ramos, M., Rohde, V., Ross, A., Rott, M., Rubel, M., Ryan, D., Ryter, F., Saarelma, S., Salewski, M., Salmi, A., Sanchis-Sanchez, L., Santos, J., Sauter, O., Scarabosio, A., Schall, G., Schmid, K., Schmitz, O., Schneider, P. A., Schrittwieser, R., Schubert, M., Schwarz-Selinger, T., Schweinzer, J., Scott, B., Sehmer, T., Seliunin, E., Sertoli, M., Shabbir, A., Shalpegin, A., Shao, L., Sharapov, S., Sias, G., Siccinio, M., Sieglin, B., Sigalov, A., Silva, A., Silva, C., Silvagni, D., Simon, P., Simpson, J., Smigelskis, E., Snicker, A., Sommariva, C., Sozzi, C., Spolaore, M., Stegmeir, A., Stejner, M., Stober, J., Stroth, U., Strumberger, E., Suarez, G., Sun, H. -J., Suttrop, W., Sytova, E., Szepesi, T., Tal, B., Tala, T., Tardini, G., Tardocchi, M., Teschke, M., Terranova, D., Tierens, W., Thoren, E., Told, D., Tolias, P., Tudisco, O., Treutterer, W., Trier, E., Tripsky, M., Valisa, M., Valovic, M., Vanovac, B., Van Vugt, D., Varoutis, S., Verdoolaege, G., Vianello, N., Vicente, J., Vierle, T., Viezzer, E., Von Toussaint, U., Wagner, D., Wang, N., Wang, X., Weiland, M., White, A. E., Wiesen, S., Willensdorfer, M., Wiringer, B., Wischmeier, M., Wolf, R., Wolfrum, E., Xiang, L., Yang, Q., Yang, Z., Yu, Q., Zagorski, R., Zammuto, I., Zhang, W., Van Zeeland, M., Zehetbauer, T., Zilker, M., Zoletnik, S., Zohm, H., ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, and EUROfusion MST1 Team

Subjects
Magnetic confinement, Edge-localized modes (ELMs), Nuclear engineering, PLASMAS, Nuclear physics, 01 natural sciences, 010305 fluids & plasmas, ASDEX Upgrade, ITER, MODE, Physics, iter, Divertor, magnetic confinement, Magnetic confinement fusion, mode, Dissipation, Condensed Matter Physics, ddc, Tokamak physics, Física nuclear, tokamak physics, Tokamaks, FLUX, Nuclear and High Energy Physics, Technology and Engineering, DEMO, nuclear fusion, Electron cyclotron resonance, Resonant magnetic perturbations, Physics::Plasma Physics, 0103 physical sciences, Nuclear fusion, ddc:530, 010306 general physics, SOLID TUNGSTEN DIVERTOR, Física [Àrees temàtiques de la UPC], demo, plasmas, solid tungsten divertor, flux, ___, HEAVY ALLOYS, Magnetohydrodynamics, [PHYS.ASTR]Physics [physics]/Astrophysics [astro-ph], heavy alloys
Abstract

The ASDEX Upgrade (AUG) programme, jointly run with the EUROfusion MST1 task force, continues to significantly enhance the physics base of ITER and DEMO. Here, the full tungsten wall is a key asset for extrapolating to future devices. The high overall heating power, flexible heating mix and comprehensive diagnostic set allows studies ranging from mimicking the scrape-off-layer and divertor conditions of ITER and DEMO at high density to fully non-inductive operation (q95 = 5.5, ) at low density. Higher installed electron cyclotron resonance heating power 6 MW, new diagnostics and improved analysis techniques have further enhanced the capabilities of AUG. Stable high-density H-modes with MW m−1 with fully detached strike-points have been demonstrated. The ballooning instability close to the separatrix has been identified as a potential cause leading to the H-mode density limit and is also found to play an important role for the access to small edge-localized modes (ELMs). Density limit disruptions have been successfully avoided using a path-oriented approach to disruption handling and progress has been made in understanding the dissipation and avoidance of runaway electron beams. ELM suppression with resonant magnetic perturbations is now routinely achieved reaching transiently . This gives new insight into the field penetration physics, in particular with respect to plasma flows. Modelling agrees well with plasma response measurements and a helically localised ballooning structure observed prior to the ELM is evidence for the changed edge stability due to the magnetic perturbations. The impact of 3D perturbations on heat load patterns and fast-ion losses have been further elaborated. Progress has also been made in understanding the ELM cycle itself. Here, new fast measurements of and Er allow for inter ELM transport analysis confirming that Er is dominated by the diamagnetic term even for fast timescales. New analysis techniques allow detailed comparison of the ELM crash and are in good agreement with nonlinear MHD modelling. The observation of accelerated ions during the ELM crash can be seen as evidence for the reconnection during the ELM. As type-I ELMs (even mitigated) are likely not a viable operational regime in DEMO studies of 'natural' no ELM regimes have been extended. Stable I-modes up to have been characterised using -feedback. Core physics has been advanced by more detailed characterisation of the turbulence with new measurements such as the eddy tilt angle—measured for the first time—or the cross-phase angle of and fluctuations. These new data put strong constraints on gyro-kinetic turbulence modelling. In addition, carefully executed studies in different main species (H, D and He) and with different heating mixes highlight the importance of the collisional energy exchange for interpreting energy confinement. A new regime with a hollow profile now gives access to regimes mimicking aspects of burning plasma conditions and lead to nonlinear interactions of energetic particle modes despite the sub-Alfvénic beam energy. This will help to validate the fast-ion codes for predicting ITER and DEMO. This work has been carried out within the framework of the EUROfusion Consortium and has received funding from the Euratom research and training programme 2014–2018 and 2019–2020 under grant agreement No. 633053. The views and opinions expressed herein do not necessarily reflect those of the European Commission. "Article signat per més de 100 autors/es: H. Meyer, for the AUG Team: D. Aguiam, C. Angioni, C.G. Albert, N. Arden, R. Arredondo Parra, O. Asunta, M. de Baar, M. Balden, V. Bandaru, K. Behler, A. Bergmann, J. Bernardo, M. Bernert, A. Biancalani, R. Bilato, G. Birkenmeier, T.C. Blanken, V. Bobkov, A. Bock, T. Bolzonella, A. Bortolon, B. Böswirth, C. Bottereau, A. Bottino, H. van den Brand, S. Brezinsek, D. Brida, F. Brochard, C. Bruhn, J. Buchanan, A. Buhler, A. Burckhart, Y. Camenen, D. Carlton, M. Carr, D. Carralero, C. Castaldo, M. Cavedon, C. Cazzaniga, S. Ceccuzzi, C. Challis, A. Chankin, S. Chapman, C. Cianfarani, F. Clairet, S. Coda, R. Coelho, J.W. Coenen, L. Colas, G.D. Conway, S. Costea, D.P. Coster, T.B. Cote, A. Creely, G. Croci, G. Cseh, A. Czarnecka, I. Cziegler, O. D'Arcangelo, P. David, C. Day, R. Delogu, P. de Marné, S.S. Denk, P. Denner, M. Dibon, A. Di Siena, D. Douai, A. Drenik, R. Drube, M. Dunne, B.P. Duval, R. Dux, T. Eich, S. Elgeti, K. Engelhardt, B. Erdös, I. Erofeev, B. Esposito, E. Fable, M. Faitsch, U. Fantz, H. Faugel, I. Faust, F. Felici, J. Ferreira, S. Fietz, A. Figuereido, R. Fischer, O. Ford, L. Frassinetti, S. Freethy, M. Fröschle, G. Fuchert, J.C. Fuchs, H. Fünfgelder, K. Galazka, J. Galdon-Quiroga, A. Gallo, Y. Gao, S. Garavaglia, A. Garcia-Carrasco, M. Garcia-Muñoz, B. Geiger, L. Giannone, L. Gil, E. Giovannozzi, C. Gleason-González, S. Glöggler, M. Gobbin, T. Görler, I. Gomez Ortiz, J. Gonzalez Martin, T. Goodman, G. Gorini, D. Gradic, A. Gräter, G. Granucci, H. Greuner, M. Griener, M. Groth, A. Gude, S. Günter, L. Guimarais, G. Haas, A.H. Hakola, C. Ham, T. Happel, N. den Harder, G.F. Harrer, J. Harrison, V. Hauer, T. Hayward-Schneider, C.C. Hegna, B. Heinemann, S. Heinzel, T. Hellsten, S. Henderson, P. Hennequin, A. Herrmann, M.F. Heyn, E. Heyn, F. Hitzler, J. Hobirk, K. Höfler, M. Hölzl, T. Höschen, J.H. Holm, C. Hopf, W.A. Hornsby, L. Horvath, A. Houben, A. Huber, V. Igochine, T. Ilkei, I. Ivanova-Stanik, W. Jacob, A.S. Jacobsen, F. Janky, A. Jansen van Vuuren, A. Jardin, F. Jaulmes, F. Jenko, T. Jensen, E. Joffrin, C.-P. Käsemann, A. Kallenbach, S. Kálvin, M. Kantor, A. Kappatou, O. Kardaun, J. Karhunen, S. Kasilov,, Y. Kazakov, W. Kernbichler, A. Kirk, S. Kjer Hansen, V. Klevarova, G. Kocsis, A. Köhn, M. Koubiti, K. Krieger, A. Krivska, A. Krämer-Flecken, O. Kudlacek, T. Kurki-Suonio, B. Kurzan, B. Labit, K. Lackner, F. Laggner, P.T. Lang, P. Lauber, A. Lebschy, N. Leuthold, M. Li, O. Linder, B. Lipschultz, F. Liu, Y. Liu, A. Lohs, Z. Lu, T. Luda di Cortemiglia, N.C. Luhmann, R. Lunsford, T. Lunt, A. Lyssoivan, T. Maceina, J. Madsen, R. Maggiora, H. Maier, O. Maj, J. Mailloux, R. Maingi, E. Maljaars, P. Manas, A. Mancini, A. Manhard, M.-E. Manso, P. Mantica, M. Mantsinen, P. Manz, M. Maraschek, C. Martens, P. Martin, L. Marrelli, A. Martitsch, M. Mayer, D. Mazon, P.J. McCarthy, R. McDermott, H. Meister, A. Medvedeva, R. Merkel, A. Merle, V. Mertens, D. Meshcheriakov, O. Meyer, J. Miettunen, D. Milanesio, F. Mink, A. Mlynek, F. Monaco, C. Moon, F. Nabais, A. Nemes-Czopf, G. Neu, R. Neu, A.H. Nielsen, S.K. Nielsen, V. Nikolaeva, M. Nocente, J.-M. Noterdaeme, I. Novikau, S. Nowak, M. Oberkofler, M. Oberparleiter, R. Ochoukov, T. Odstrcil, J. Olsen, F. Orain, F. Palermo, O. Pan, G. Papp, I. Paradela Perez, A. Pau, G. Pautasso, F. Penzel, P. Petersson, J. Pinzón Acosta, P. Piovesan, C. Piron, R. Pitts, U. Plank, B. Plaum, B. Ploeckl, V. Plyusnin, G. Pokol, E. Poli, L. Porte, S. Potzel, D. Prisiazhniuk, T. Pütterich, M. Ramisch, J. Rasmussen, G.A. Rattá, S. Ratynskaia, G. Raupp, G.L. Ravera, D. Réfy, M. Reich, F. Reimold, D. Reiser, T. Ribeiro, J. Riesch, R. Riedl, D. Rittich, J.F. Rivero-Rodriguez, G. Rocchi, M. Rodriguez-Ramos, V. Rohde, A. Ross1, M. Rott, M. Rubel, D. Ryan, F. Ryter, S. Saarelma, M. Salewski, A. Salmi, L. Sanchis-Sanchez, J. Santos, O. Sauter, A. Scarabosio, G. Schall, K. Schmid, O. Schmitz, P.A. Schneider, R. Schrittwieser, M. Schubert, T. Schwarz-Selinger, J. Schweinzer, B. Scott, T. Semer, E. Seliunin, M. Sertoli, A. Shabbir, A. Shalpegin, L. Shao, S. Sharapov, G. Sias, M. Siccinio, B. Sieglin, A. Sigalov, A. Silva, C. Silva, D. Silvagni, P. Simon, J. Simpson, E. Smigelskis, A. Snicker, C. Sommariva, C. Sozzi, M. Spolaore, A. Stegmeir, M. Stejner, J. Stober, U. Stroth, E. Strumberger, G. Suarez, H.-J. Sun, W. Suttrop, E. Sytova, T. Szepesi, B. Tál, T. Tala, G. Tardini, M. Tardocchi, M. Teschke, D. Terranova, W. Tierens, E. Thorén, D. Told, P. Tolias, O. Tudisco, W. Treutterer, E. Trier, M. Tripský, M. Valisa, M. Valovic, B. Vanovac, D. van Vugt, S. Varoutis, G. Verdoolaege, N. Vianello, J. Vicente, T. Vierle, E. Viezzer, U. von Toussaint, D. Wagner, N. Wang, X. Wang, M. Weiland, A.E. White, S. Wiesen, M. Willensdorfer, B. Wiringer, M. Wischmeier, R. Wolf, E. Wolfrum, L. Xiang, Q. Yang, Z. Yang, Q. Yu, R. Zagórski, I. Zammuto, W. Zhang, M. van Zeeland, T. Zehetbauer, M. Zilker, S. Zoletnik, H. Zohm and the EUROfusion MST1 Team55

Published
2018

36. SOLPS-ITER simulations of an X-point radiator in the ASDEX Upgrade tokamak

Author

O. Pan, M. Bernert, T. Lunt, M. Cavedon, B. Kurzan, S. Wiesen, M. Wischmeier, U. Stroth, the ASDEX Upgrade Team, ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, Pan, O, Bernert, M, Lunt, T, Cavedon, M, Kurzan, B, Wiesen, S, Wischmeier, M, and Stroth, U

Subjects
Nuclear and High Energy Physics, power exhaust, Paper, X-point radiator, SOLPS-ITER, Condensed Matter Physics, ddc
Abstract

The X-point radiator (XPR) is an attractive scenario that may contribute to solving the power exhaust problem in future fusion devices. The 2D transport code SOLPS-ITER was applied to reproduce the experimentally measured plasma condition with an XPR in the ASDEX Upgrade tokamak and to compare with a reduced model. Neutrals penetrating from the adjoining cold divertor region and the large connection length near the X-point play an important role in initiating an XPR. However, once such a radiator is created, it persists even if the fueling and impurity seeding rates were reduced. The redistribution of plasma density and radiation near the X-point caused by fluid drifts at the XPR was studied in the simulation.

Published
2023

37. Progress from ASDEX Upgrade experiments in preparing the physics basis of ITER operation and DEMO scenario development

Author

U. Stroth, D. Aguiam, E. Alessi, C. Angioni, N. Arden, R. Arredondo Parra, V. Artigues, O. Asunta, M. Balden, V. Bandaru, A. Banon-Navarro, K. Behler, A. Bergmann, M. Bergmann, J. Bernardo, M. Bernert, A. Biancalani, R. Bielajew, R. Bilato, G. Birkenmeier, T. Blanken, V. Bobkov, A. Bock, T. Body, T. Bolzonella, N. Bonanomi, A. Bortolon, B. Böswirth, C. Bottereau, A. Bottino, H. van den Brand, M. Brenzke, S. Brezinsek, D. Brida, F. Brochard, C. Bruhn, J. Buchanan, A. Buhler, A. Burckhart, Y. Camenen, B. Cannas, P. Cano Megias, D. Carlton, M. Carr, P. Carvalho, C. Castaldo, M. Cavedon, C. Cazzaniga, C. Challis, A. Chankin, C. Cianfarani, F. Clairet, S. Coda, R. Coelho, J.W. Coenen, L. Colas, G. Conway, S. Costea, D. Coster, T. Cote, A.J. Creely, G. Croci, D.J. Cruz Zabala, G. Cseh, A. Czarnecka, I. Cziegler, O. D’Arcangelo, A. Dal Molin, P. David, C. Day, M. de Baar, P. de Marné, R. Delogu, S. Denk, P. Denner, A. Di Siena, J.J. Dominguez Palacios Durán, D. Dunai, A. Drenik, M. Dreval, R. Drube, M. Dunne, B.P. Duval, R. Dux, T. Eich, S. Elgeti, A. Encheva, K. Engelhardt, B. Erdös, I. Erofeev, B. Esposito, E. Fable, M. Faitsch, U. Fantz, M. Farnik, H. Faugel, F. Felici, O. Ficker, S. Fietz, A. Figueredo, R. Fischer, O. Ford, L. Frassinetti, M. Fröschle, G. Fuchert, J.C. Fuchs, H. Fünfgelder, S. Futatani, K. Galazka, J. Galdon-Quiroga, D. Gallart Escolà, A. Gallo, Y. Gao, S. Garavaglia, M. Garcia Muñoz, B. Geiger, L. Giannone, S. Gibson, L. Gil, E. Giovannozzi, S. Glöggler, M. Gobbin, J. Gonzalez Martin, T. Goodman, G. Gorini, T. Görler, D. Gradic, G. Granucci, A. Gräter, H. Greuner, M. Griener, M. Groth, A. Gude, L. Guimarais, S. Günter, G. Haas, A.H. Hakola, C. Ham, T. Happel, N. den Harder, G. Harrer, J. Harrison, V. Hauer, T. Hayward-Schneider, B. Heinemann, T. Hellsten, S. Henderson, P. Hennequin, A. Herrmann, E. Heyn, F. Hitzler, J. Hobirk, K. Höfler, J.H. Holm, M. Hölzl, C. Hopf, L. Horvath, T. Höschen, A. Houben, A. Hubbard, A. Huber, K. Hunger, V. Igochine, M. Iliasova, T. Ilkei, K. Insulander Björk, C. Ionita-Schrittwieser, I. Ivanova-Stanik, W. Jacob, N. Jaksic, F. Janky, A. Jansen van Vuuren, A. Jardin, F. Jaulmes, F. Jenko, T. Jensen, E. Joffrin, A. Kallenbach, S. Kálvin, M. Kantor, A. Kappatou, O. Kardaun, J. Karhunen, C.-P. Käsemann, S. Kasilov, A. Kendl, W. Kernbichler, E. Khilkevitch, A. Kirk, S. Kjer Hansen, V. Klevarova, G. Kocsis, M. Koleva, M. Komm, M. Kong, A. Krämer-Flecken, K. Krieger, A. Krivska, O. Kudlacek, T. Kurki-Suonio, B. Kurzan, B. Labit, K. Lackner, F. Laggner, A. Lahtinen, P.T. Lang, P. Lauber, N. Leuthold, L. Li, J. Likonen, O. Linder, B. Lipschultz, Y. Liu, A. Lohs, Z. Lu, T. Luda di Cortemiglia, N.C. Luhmann, T. Lunt, A. Lyssoivan, T. Maceina, J. Madsen, A. Magnanimo, H. Maier, J. Mailloux, R. Maingi, O. Maj, E. Maljaars, P. Manas, A. Mancini, A. Manhard, P. Mantica, M. Mantsinen, P. Manz, M. Maraschek, C. Marchetto, L. Marrelli, P. Martin, A. Martitsch, F. Matos, M. Mayer, M.-L. Mayoral, D. Mazon, P.J. McCarthy, R. McDermott, R. Merkel, A. Merle, D. Meshcheriakov, H. Meyer, D. Milanesio, P. Molina Cabrera, F. Monaco, M. Muraca, F. Nabais, V. Naulin, R. Nazikian, R.D. Nem, A. Nemes-Czopf, G. Neu, R. Neu, A.H. Nielsen, S.K. Nielsen, T. Nishizawa, M. Nocente, J.-M. Noterdaeme, I. Novikau, S. Nowak, M. Oberkofler, R. Ochoukov, J. Olsen, F. Orain, F. Palermo, O. Pan, G. Papp, I. Paradela Perez, A. Pau, G. Pautasso, C. Paz-Soldan, P. Petersson, P. Piovesan, C. Piron, U. Plank, B. Plaum, B. Plöck, V. Plyusnin, G. Pokol, E. Poli, L. Porte, T. Pütterich, M. Ramisch, J. Rasmussen, G. Ratta, S. Ratynskaia, G. Raupp, D. Réfy, M. Reich, F. Reimold, D. Reiser, M. Reisner, D. Reiter, T. Ribeiro, R. Riedl, J. Riesch, D. Rittich, J.F. Rivero Rodriguez, G. Rocchi, P. Rodriguez-Fernandez, M. Rodriguez-Ramos, V. Rohde, G. Ronchi, A. Ross, M. Rott, M. Rubel, D.A. Ryan, F. Ryter, S. Saarelma, M. Salewski, A. Salmi, O. Samoylov, L. Sanchis Sanchez, J. Santos, O. Sauter, G. Schall, K. Schlüter, K. Schmid, O. Schmitz, P.A. Schneider, R. Schrittwieser, M. Schubert, C. Schuster, T. Schwarz-Selinger, J. Schweinzer, E. Seliunin, A. Shabbir, A. Shalpegin, S. Sharapov, U. Sheikh, A. Shevelev, G. Sias, M. Siccinio, B. Sieglin, A. Sigalov, A. Silva, C. Silva, D. Silvagni, J. Simpson, S. Sipilä, E. Smigelskis, A. Snicker, E. Solano, C. Sommariva, C. Sozzi, G. Spizzo, M. Spolaore, A. Stegmeir, M. Stejner, J. Stober, E. Strumberge, G. Suarez Lopez, H.-J. Sun, W. Suttrop, E. Sytova, T. Szepesi, B. Tál, T. Tala, G. Tardini, M. Tardocchi, D. Terranova, M. Teschke, E. Thorén, W. Tierens, D. Told, W. Treutterer, G. Trevisan, E. Trier, M. Tripský, M. Usoltceva, M. Valisa, M. Valovic, M. van Zeeland, F. Vannini, B. Vanovac, P. Varela, S. Varoutis, N. Vianello, J. Vicente, G. Verdoolaege, T. Vierle, E. Viezzer, I. Voitsekhovitch, U. von Toussaint, D. Wagner, X. Wang, M. Weiland, A.E. White, M. Willensdorfer, B. Wiringer, M. Wischmeier, R. Wolf, E. Wolfrum, Q. Yang, Q. Yu, R. Zagórski, I. Zammuto, T. Zehetbauer, W. Zhang, W. Zholobenko, M. Zilker, A. Zito, H. Zohm, S. Zoletnik, the EUROfusion MST1 Team, Max-Planck-Institut für Plasmaphysik [Garching] (IPP), Institut de Recherche sur la Fusion par confinement Magnétique (IRFM), Commissariat à l'énergie atomique et aux énergies alternatives (CEA), Aix Marseille Université (AMU), Laboratoire de Physique des Plasmas (LPP), Observatoire de Paris, Université Paris sciences et lettres (PSL)-Université Paris sciences et lettres (PSL)-École polytechnique (X)-Sorbonne Université (SU)-Université Paris-Saclay-Centre National de la Recherche Scientifique (CNRS), EUROfusion MST1 Team, Barcelona Supercomputing Center, Department of Applied Physics, Aalto-yliopisto, Aalto University, Stroth, U, Aguiam, D, Alessi, E, Angioni, C, Arden, N, Parra, R, Artigues, V, Asunta, O, Balden, M, Bandaru, V, Banon-Navarro, A, Behler, K, Bergmann, A, Bergmann, M, Bernardo, J, Bernert, M, Biancalani, A, Bielajew, R, Bilato, R, Birkenmeier, G, Blanken, T, Bobkov, V, Bock, A, Body, T, Bolzonella, T, Bonanomi, N, Bortolon, A, Boswirth, B, Bottereau, C, Bottino, A, Van Den Brand, H, Brenzke, M, Brezinsek, S, Brida, D, Brochard, F, Bruhn, C, Buchanan, J, Buhler, A, Burckhart, A, Camenen, Y, Cannas, B, Megias, P, Carlton, D, Carr, M, Carvalho, P, Castaldo, C, Cavedon, M, Cazzaniga, C, Challis, C, Chankin, A, Cianfarani, C, Clairet, F, Coda, S, Coelho, R, Coenen, J, Colas, L, Conway, G, Costea, S, Coster, D, Cote, T, Creely, A, Croci, G, Zabala, D, Cseh, G, Czarnecka, A, Cziegler, I, D'Arcangelo, O, Molin, A, David, P, Day, C, De Baar, M, De Marne, P, Delogu, R, Denk, S, Denner, P, Di Siena, A, Palacios Duran, J, Dunai, D, Drenik, A, Dreval, M, Drube, R, Dunne, M, Duval, B, Dux, R, Eich, T, Elgeti, S, Encheva, A, Engelhardt, K, Erdos, B, Erofeev, I, Esposito, B, Fable, E, Faitsch, M, Fantz, U, Farnik, M, Faugel, H, Felici, F, Ficker, O, Fietz, S, Figueredo, A, Fischer, R, Ford, O, Frassinetti, L, Froschle, M, Fuchert, G, Fuchs, J, Funfgelder, H, Futatani, S, Galazka, K, Galdon-Quiroga, J, Escola, D, Gallo, A, Gao, Y, Garavaglia, S, Munoz, M, Geiger, B, Giannone, L, Gibson, S, Gil, L, Giovannozzi, E, Gloggler, S, Gobbin, M, Martin, J, Goodman, T, Gorini, G, Gorler, T, Gradic, D, Granucci, G, Grater, A, Greuner, H, Griener, M, Groth, M, Gude, A, Guimarais, L, Gunter, S, Haas, G, Hakola, A, Ham, C, Happel, T, Den Harder, N, Harrer, G, Harrison, J, Hauer, V, Hayward-Schneider, T, Heinemann, B, Hellsten, T, Henderson, S, Hennequin, P, Herrmann, A, Heyn, E, Hitzler, F, Hobirk, J, Hofler, K, Holm, J, Holzl, M, Hopf, C, Horvath, L, Hoschen, T, Houben, A, Hubbard, A, Huber, A, Hunger, K, Igochine, V, Iliasova, M, Ilkei, T, Bjork, K, Ionita-Schrittwieser, C, Ivanova-Stanik, I, Jacob, W, Jaksic, N, Janky, F, Jansen Van Vuuren, A, Jardin, A, Jaulmes, F, Jenko, F, Jensen, T, Joffrin, E, Kallenbach, A, Kalvin, S, Kantor, M, Kappatou, A, Kardaun, O, Karhunen, J, Kasemann, C, Kasilov, S, Kendl, A, Kernbichler, W, Khilkevitch, E, Kirk, A, Hansen, S, Klevarova, V, Kocsis, G, Koleva, M, Komm, M, Kong, M, Kramer-Flecken, A, Krieger, K, Krivska, A, Kudlacek, O, Kurki-Suonio, T, Kurzan, B, Labit, B, Lackner, K, Laggner, F, Lahtinen, A, Lang, P, Lauber, P, Leuthold, N, Li, L, Likonen, J, Linder, O, Lipschultz, B, Liu, Y, Lohs, A, Lu, Z, Luda Di Cortemiglia, T, Luhmann, N, Lunt, T, Lyssoivan, A, Maceina, T, Madsen, J, Magnanimo, A, Maier, H, Mailloux, J, Maingi, R, Maj, O, Maljaars, E, Manas, P, Mancini, A, Manhard, A, Mantica, P, Mantsinen, M, Manz, P, Maraschek, M, Marchetto, C, Marrelli, L, Martin, P, Martitsch, A, Matos, F, Mayer, M, Mayoral, M, Mazon, D, Mccarthy, P, Mcdermott, R, Merkel, R, Merle, A, Meshcheriakov, D, Meyer, H, Milanesio, D, Cabrera, P, Monaco, F, Muraca, M, Nabais, F, Naulin, V, Nazikian, R, Nem, R, Nemes-Czopf, A, Neu, G, Neu, R, Nielsen, A, Nielsen, S, Nishizawa, T, Nocente, M, Noterdaeme, J, Novikau, I, Nowak, S, Oberkofler, M, Ochoukov, R, Olsen, J, Orain, F, Palermo, F, Pan, O, Papp, G, Perez, I, Pau, A, Pautasso, G, Paz-Soldan, C, Petersson, P, Piovesan, P, Piron, C, Plank, U, Plaum, B, Plock, B, Plyusnin, V, Pokol, G, Poli, E, Porte, L, Putterich, T, Ramisch, M, Rasmussen, J, Ratta, G, Ratynskaia, S, Raupp, G, Refy, D, Reich, M, Reimold, F, Reiser, D, Reisner, M, Reiter, D, Ribeiro, T, Riedl, R, Riesch, J, Rittich, D, Rodriguez, J, Rocchi, G, Rodriguez-Fernandez, P, Rodriguez-Ramos, M, Rohde, V, Ronchi, G, Ross, A, Rott, M, Rubel, M, Ryan, D, Ryter, F, Saarelma, S, Salewski, M, Salmi, A, Samoylov, O, Sanchez, L, Santos, J, Sauter, O, Schall, G, Schluter, K, Schmid, K, Schmitz, O, Schneider, P, Schrittwieser, R, Schubert, M, Schuster, C, Schwarz-Selinger, T, Schweinzer, J, Seliunin, E, Shabbir, A, Shalpegin, A, Sharapov, S, Sheikh, U, Shevelev, A, Sias, G, Siccinio, M, Sieglin, B, Sigalov, A, Silva, A, Silva, C, Silvagni, D, Simpson, J, Sipila, S, Smigelskis, E, Snicker, A, Solano, E, Sommariva, C, Sozzi, C, Spizzo, G, Spolaore, M, Stegmeir, A, Stejner, M, Stober, J, Strumberge, E, Lopez, G, Sun, H, Suttrop, W, Sytova, E, Szepesi, T, Tal, B, Tala, T, Tardini, G, Tardocchi, M, Terranova, D, Teschke, M, Thoren, E, Tierens, W, Told, D, Treutterer, W, Trevisan, G, Trier, E, Tripsky, M, Usoltceva, M, Valisa, M, Valovic, M, Van Zeeland, M, Vannini, F, Vanovac, B, Varela, P, Varoutis, S, Vianello, N, Vicente, J, Verdoolaege, G, Vierle, T, Viezzer, E, Voitsekhovitch, I, Von Toussaint, U, Wagner, D, Wang, X, Weiland, M, White, A, Willensdorfer, M, Wiringer, B, Wischmeier, M, Wolf, R, Wolfrum, E, Yang, Q, Yu, Q, Zagorski, R, Zammuto, I, Zehetbauer, T, Zhang, W, Zholobenko, W, Zilker, M, Zito, A, Zohm, H, and Zoletnik, S

Subjects
Nuclear and High Energy Physics, Asdex Upgrade, confinement, ELLM-free discharges, sol, Computer science, Nuclear engineering, ALCATOR C-MOD, UPPER DIVERTOR, ASDEX Upgrade, Physics::Plasma Physics, [PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph], Simulació per ordinador, alcator c-mod, ddc:530, upper divertor, ELLM-free discharge, SOL, Basis (linear algebra), Physics, turbulence, transition, h-mode plasmas, Condensed Matter Physics, ddc, Informàtica::Aplicacions de la informàtica::Aplicacions informàtiques a la física i l‘enginyeria [Àrees temàtiques de la UPC], Fusion reactors, Physics and Astronomy, CONFINEMENT MODES, H-MODE PLASMAS, Physics::Space Physics, Nuclear fusion, TURBULENCE, ddc:620, confinement modes, TRANSITION
Abstract

An overview of recent results obtained at the tokamak ASDEX Upgrade (AUG) is given. A work flow for predictive profile modelling of AUG discharges was established which is able to reproduce experimental H-mode plasma profiles based on engineering parameters only. In the plasma center, theoretical predictions on plasma current redistribution by a dynamo effect were confirmed experimentally. For core transport, the stabilizing effect of fast ion distributions on turbulent transport is shown to be important to explain the core isotope effect and improves the description of hollow low-Z impurity profiles. The L–H power threshold of hydrogen plasmas is not affected by small helium admixtures and it increases continuously from the deuterium to the hydrogen level when the hydrogen concentration is raised from 0 to 100%. One focus of recent campaigns was the search for a fusion relevant integrated plasma scenario without large edge localised modes (ELMs). Results from six different ELM-free confinement regimes are compared with respect to reactor relevance: ELM suppression by magnetic perturbation coils could be attributed to toroidally asymmetric turbulent fluctuations in the vicinity of the separatrix. Stable improved confinement mode plasma phases with a detached inner divertor were obtained using a feedback control of the plasma β. The enhanced Dα H-mode regime was extended to higher heating power by feedback controlled radiative cooling with argon. The quasi-coherent exhaust regime was developed into an integrated scenario at high heating power and energy confinement, with a detached divertor and without large ELMs. Small ELMs close to the separatrix lead to peeling-ballooning stability and quasi continuous power exhaust. Helium beam density fluctuation measurements confirm that transport close to the separatrix is important to achieve the different ELM-free regimes. Based on separatrix plasma parameters and interchange-drift-Alfvén turbulence, an analytic model was derived that reproduces the experimentally found important operational boundaries of the density limit and between L- and H-mode confinement. Feedback control for the X-point radiator (XPR) position was established as an important element for divertor detachment control. Stable and detached ELM-free phases with H-mode confinement quality were obtained when the XPR was moved 10 cm above the X-point. Investigations of the plasma in the future flexible snow-flake divertor of AUG by means of first SOLPS-ITER simulations with drifts activated predict beneficial detachment properties and the activation of an additional strike point by the drifts. This work has been carried out within the framework of the EUROfusion Consortium and has received funding from the Euratom research and training programme 2014–2018 and 2019–2020 under Grant Agreement No. 633053. The views and opinions expressed herein do not necessarily reflect those of the European Commission. Peer Reviewed "Article signat per més de 50 autors/es: U. Stroth, D. Aguiam, E. Alessi, C. Angioni, N. Arden, R. Arredondo Parra, V. Artigues, O. Asunta, M. Balden, V. Bandaru, A. Banon-Navarro, K. Behler, A. Bergmann, M. Bergmann, J. Bernardo, M. Bernert, A. Biancalani, R. Bielajew, R. Bilato, G. Birkenmeier, T. Blanken, V. Bobkov, A. Bock, T. Body, T. Bolzonella, N. Bonanomi, A. Bortolon, B. Böswirth, C. Bottereau, A. Bottino, H. van den Brand, M. Brenzke, S. Brezinsek, D. Brida, F. Brochard, C. Bruhn, J. Buchanan, A. Buhler, A. Burckhart, Y. Camenen, B. Cannas, P. Cano Megias, D. Carlton, M. Carr, P. Carvalho, C. Castaldo, M. Cavedon, C. Cazzaniga, C. Challis, A. Chankin, C. Cianfarani, F. Clairet, S. Coda, R. Coelho, J.W. Coenen, L. Colas, G. Conway, S. Costea, D. Coster, T. Cote, A.J. Creely, G. Croci, D.J. Cruz Zabala, G. Cseh, A. Czarnecka, I. Cziegler, O. D'Arcangelo, A. Dal Molin, P. David, C. Day, M. de Baar, P. de Marné, R. Delogu, S. Denk, P. Denner, A. Di Siena, J.J. Dominguez Palacios Durán, D. Dunai, A. Drenik, M. Dreval, R. Drube, M. Dunne, B.P. Duval, R. Dux, T. Eich, S. Elgeti, A. Encheva, K. Engelhardt, B. Erdös, I. Erofeev, B. Esposito, E. Fable, M. Faitsch, U. Fantz, M. Farnik, H. Faugel, F. Felici, O. Ficker, S. Fietz, A. Figueredo, R. Fischer, O. Ford, L. Frassinetti, M. Fröschle, G. Fuchert, J.C. Fuchs, H. Fünfgelder, S. Futatani, K. Galazka, J. Galdon-Quiroga, D. Gallart Escolà, A. Gallo10, Y. Gao11, S. Garavaglia3, M. Garcia Muñoz16, B. Geiger21, L. Giannone1, S. Gibson32, L. Gil2, E. Giovannozzi18, S. Glöggler1, M. Gobbin8, J. Gonzalez Martin, T. Goodman, G. Gorini, T. Görler, D. Gradic, G. Granucci, A. Gräter, H. Greuner, M. Griener, M. Groth, A. Gude, L. Guimarais, S. Günter, G. Haas, A.H. Hakola, C. Ham, T. Happel, N. den Harder, G. Harrer, J. Harrison, V. Hauer, T. Hayward-Schneider, B. Heinemann, T. Hellsten, S. Henderson, P. Hennequin, A. Herrmann, E. Heyn, F. Hitzler, J. Hobirk, K. Höfler, J.H. Holm, M. Hölzl, C. Hopf, L. Horvath, T. Höschen, A. Houben, A. Hubbard, A. Huber, K. Hunger, V. Igochine, M. Iliasova, T. Ilkei, K. Insulander Björk, C. Ionita-Schrittwieser, I. Ivanova-Stanik, W. Jacob, N. Jaksic, F. Janky, A. Jansen van Vuuren, A. Jardin, F. Jaulmes, F. Jenko, T. Jensen, E. Joffrin, A. Kallenbach, S. Kálvin, M. Kantor, A. Kappatou, O. Kardaun, J. Karhunen4, C.-P. Käsemann, S. Kasilov, A. Kendl, W. Kernbichler, E. Khilkevitch, A. Kirk, S. Kjer Hansen, V. Klevarova, G. Kocsis, M. Koleva, M. Komm, M. Kong, A. Krämer-Flecken, K. Krieger, A. Krivska, O. Kudlacek, T. Kurki-Suonio, B. Kurzan, B. Labit, K. Lackner, F. Laggner, A. Lahtinen, P.T. Lang, P. Lauber, N. Leuthold, L. Li, J. Likonen, O. Linder, B. Lipschultz, Y. Liu, A. Lohs, Z. Lu, T. Luda di Cortemiglia, N.C. Luhmann, T. Lunt, A. Lyssoivan, T. Maceina, J. Madsen, A. Magnanimo, H. Maier, J. Mailloux, R. Maingi, O. Maj, E. Maljaars, P. Manas, A. Mancini, A. Manhard, P. Mantica, M. Mantsinen, P. Manz, M. Maraschek, C. Marchetto, L. Marrelli, P. Martin, A. Martitsch, F. Matos, M. Mayer, M.-L. Mayoral, D. Mazon, P.J. McCarthy, R. McDermott, R. Merkel, A. Merle, D. Meshcheriakov, H. Meyer, D. Milanesio, P. Molina Cabrera, F. Monaco, M. Muraca, F. Nabais, V. Naulin, R. Nazikian, R.D. Nem, A. Nemes-Czopf, G. Neu, R. Neu, A.H. Nielsen, S.K. Nielsen, T. Nishizawa, M. Nocente, J.-M. Noterdaeme, I. Novikau, S. Nowak, M. Oberkofler, R. Ochoukov, J. Olsen, F. Orain, F. Palermo, O. Pan, G. Papp, I. Paradela Perez, A. Pau, G. Pautasso, C. Paz-Soldan, P. Petersson, P. Piovesan, C. Piron, U. Plank, B. Plaum, B. Plöck, V. Plyusnin, G. Pokol, E. Poli, L. Porte, T. Pütterich, M. Ramisch, J. Rasmussen, G. Ratta, S. Ratynskaia, G. Raupp, D. Réfy, M. Reich1, F. Reimold, D. Reiser, M. Reisner, D. Reiter, T. Ribeiro, R. Riedl, J. Riesch, D. Rittich, J.F. Rivero Rodriguez, G. Rocchi, P. Rodriguez-Fernandez, M. Rodriguez-Ramos, V. Rohde, G. Ronchi, A. Ross, M. Rott, M. Rubel, D.A. Ryan, F. Ryter, S. Saarelma, M. Salewski, A. Salmi, O. Samoylov, L. Sanchis Sanchez, J. Santos, O. Sauter, G. Schall, K. Schlüter, K. Schmid, O. Schmitz, P.A. Schneider, R. Schrittwieser, M. Schubert, C. Schuster, T. Schwarz-Selinger, J. Schweinzer, E. Seliunin, A. Shabbir, A. Shalpegin, S. Sharapov, U. Sheikh, A. Shevelev, G. Sias, M. Siccinio, B. Sieglin, A. Sigalov, A. Silva, C. Silva, D. Silvagni, J. Simpson, S. Sipilä, E. Smigelskis, A. Snicker, E. Solano, C. Sommariva, C. Sozzi, G. Spizzo, M. Spolaore, A. Stegmeir, M. Stejner, J. Stober, E. Strumberge1, G. Suarez Lopez, H.-J. Sun, W. Suttrop, E. Sytova, T. Szepesi, B. Tál, T. Tala, G. Tardini, M. Tardocchi, D. Terranova, M. Teschke, E. Thorén, W. Tierens, D. Told, W. Treutterer, G. Trevisan, E. Trier, M. Tripský, M. Usoltceva, M. Valisa, M. Valovic, M. van Zeeland, F. Vannini, B. Vanovac, P. Varela, S. Varoutis, N. Vianello, J. Vicente, G. Verdoolaege, T. Vierle, E. Viezzer, I. Voitsekhovitch, U. von Toussaint, D. Wagner, X. Wang, M. Weiland, A.E. White, M. Willensdorfer, B. Wiringer, M. Wischmeier, R. Wolf, E. Wolfrum, Q. Yang, Q. Yu, R. Zagórski, I. Zammuto, T. Zehetbauer, W. Zhang, W. Zholobenko, M. Zilker, A. Zito, H. Zohm, S. Zoletnik and the EUROfusion MST1 Team "

Published
2022

38. Overview of the TCV tokamak experimental programme

Author

H. Reimerdes, M. Agostini, E. Alessi, S. Alberti, Y. Andrebe, H. Arnichand, J. Balbin, F. Bagnato, M. Baquero-Ruiz, M. Bernert, W. Bin, P. Blanchard, T.C. Blanken, J.A. Boedo, D. Brida, S. Brunner, C. Bogar, O. Bogar, T. Bolzonella, F. Bombarda, F. Bouquey, C. Bowman, D. Brunetti, J. Buermans, H. Bufferand, L. Calacci, Y. Camenen, S. Carli, D. Carnevale, F. Carpanese, F. Causa, J. Cavalier, M. Cavedon, J.A. Cazabonne, J. Cerovsky, R. Chandra, A. Chandrarajan Jayalekshmi, O. Chellaï, P. Chmielewski, D. Choi, G. Ciraolo, I.G.J. Classen, S. Coda, C. Colandrea, A. Dal Molin, P. David, M.R. de Baar, J. Decker, W. Dekeyser, H. de Oliveira, D. Douai, M. Dreval, M.G. Dunne, B.P. Duval, S. Elmore, O. Embreus, F. Eriksson, M. Faitsch, G. Falchetto, M. Farnik, A. Fasoli, N. Fedorczak, F. Felici, O. Février, O. Ficker, A. Fil, M. Fontana, E. Fransson, L. Frassinetti, I. Furno, D.S. Gahle, D. Galassi, K. Galazka, C. Galperti, S. Garavaglia, M. Garcia-Munoz, B. Geiger, M. Giacomin, G. Giruzzi, M. Gobbin, T. Golfinopoulos, T. Goodman, S. Gorno, G. Granucci, J.P. Graves, M. Griener, M. Gruca, T. Gyergyek, R. Haelterman, A. Hakola, W. Han, T. Happel, G. Harrer, J.R. Harrison, S. Henderson, G.M.D. Hogeweij, J.-P. Hogge, M. Hoppe, J. Horacek, Z. Huang, A. Iantchenko, P. Innocente, K. Insulander Björk, C. Ionita-Schrittweiser, H. Isliker, A. Jardin, R.J.E. Jaspers, R. Karimov, A.N. Karpushov, Y. Kazakov, M. Komm, M. Kong, J. Kovacic, O. Krutkin, O. Kudlacek, U. Kumar, R. Kwiatkowski, B. Labit, L. Laguardia, J.T. Lammers, E. Laribi, E. Laszynska, A. Lazaros, O. Linder, B. Linehan, B. Lipschultz, X. Llobet, J. Loizu, T. Lunt, E. Macusova, Y. Marandet, M. Maraschek, G. Marceca, C. Marchetto, S. Marchioni, E.S. Marmar, Y. Martin, L. Martinelli, F. Matos, R. Maurizio, M.-L. Mayoral, D. Mazon, V. Menkovski, A. Merle, G. Merlo, H. Meyer, K. Mikszuta-Michalik, P.A. Molina Cabrera, J. Morales, J.-M. Moret, A. Moro, D. Moulton, H. Muhammed, O. Myatra, D. Mykytchuk, F. Napoli, R.D. Nem, A.H. Nielsen, M. Nocente, S. Nowak, N. Offeddu, J. Olsen, F.P. Orsitto, O. Pan, G. Papp, A. Pau, A. Perek, F. Pesamosca, Y. Peysson, L. Pigatto, C. Piron, M. Poradzinski, L. Porte, T. Pütterich, M. Rabinski, H. Raj, J.J. Rasmussen, G.A. Rattá, T. Ravensbergen, D. Ricci, P. Ricci, N. Rispoli, F. Riva, J.F. Rivero-Rodriguez, M. Salewski, O. Sauter, B.S. Schmidt, R. Schrittweiser, S. Sharapov, U.A. Sheikh, B. Sieglin, M. Silva, A. Smolders, A. Snicker, C. Sozzi, M. Spolaore, A. Stagni, L. Stipani, G. Sun, T. Tala, P. Tamain, K. Tanaka, A. Tema Biwole, D. Terranova, J.L. Terry, D. Testa, C. Theiler, A. Thornton, A. Thrysøe, H. Torreblanca, C.K. Tsui, D. Vaccaro, M. Vallar, M. van Berkel, D. Van Eester, R.J.R. van Kampen, S. Van Mulders, K. Verhaegh, T. Verhaeghe, N. Vianello, F. Villone, E. Viezzer, B. Vincent, I. Voitsekhovitch, N.M.T. Vu, N. Walkden, T. Wauters, H. Weisen, N. Wendler, M. Wensing, F. Widmer, S. Wiesen, M. Wischmeier, T.A. Wijkamp, D. Wünderlich, C. Wüthrich, V. Yanovskiy, J. Zebrowski, the EUROfusion MST1 Team, EUROfusion MST1 Team, Control Systems Technology, Liquid metal heat shields, Science and Technology of Nuclear Fusion, Group Heemels, Mechanical Engineering, Data Mining, EAISI Health, ICMS Affiliated, EAISI High Tech Systems, Applied Physics and Science Education, Reimerdes, H, Agostini, M, Alessi, E, Alberti, S, Andrebe, Y, Arnichand, H, Balbin, J, Bagnato, F, Baquero-Ruiz, M, Bernert, M, Bin, W, Blanchard, P, Blanken, T, Boedo, J, Brida, D, Brunner, S, Bogar, C, Bogar, O, Bolzonella, T, Bombarda, F, Bouquey, F, Bowman, C, Brunetti, D, Buermans, J, Bufferand, H, Calacci, L, Camenen, Y, Carli, S, Carnevale, D, Carpanese, F, Causa, F, Cavalier, J, Cavedon, M, Cazabonne, J, Cerovsky, J, Chandra, R, Chandrarajan Jayalekshmi, A, Chellai, O, Chmielewski, P, Choi, D, Ciraolo, G, Classen, I, Coda, S, Colandrea, C, Dal Molin, A, David, P, De Baar, M, Decker, J, Dekeyser, W, De Oliveira, H, Douai, D, Dreval, M, Dunne, M, Duval, B, Elmore, S, Embreus, O, Eriksson, F, Faitsch, M, Falchetto, G, Farnik, M, Fasoli, A, Fedorczak, N, Felici, F, Fevrier, O, Ficker, O, Fil, A, Fontana, M, Fransson, E, Frassinetti, L, Furno, I, Gahle, D, Galassi, D, Galazka, K, Galperti, C, Garavaglia, S, Garcia-Munoz, M, Geiger, B, Giacomin, M, Giruzzi, G, Gobbin, M, Golfinopoulos, T, Goodman, T, Gorno, S, Granucci, G, Graves, J, Griener, M, Gruca, M, Gyergyek, T, Haelterman, R, Hakola, A, Han, W, Happel, T, Harrer, G, Harrison, J, Henderson, S, Hogeweij, G, Hogge, J, Hoppe, M, Horacek, J, Huang, Z, Iantchenko, A, Innocente, P, Insulander Bjork, K, Ionita-Schrittweiser, C, Isliker, H, Jardin, A, Jaspers, R, Karimov, R, Karpushov, A, Kazakov, Y, Komm, M, Kong, M, Kovacic, J, Krutkin, O, Kudlacek, O, Kumar, U, Kwiatkowski, R, Labit, B, Laguardia, L, Lammers, J, Laribi, E, Laszynska, E, Lazaros, A, Linder, O, Linehan, B, Lipschultz, B, Llobet, X, Loizu, J, Lunt, T, Macusova, E, Marandet, Y, Maraschek, M, Marceca, G, Marchetto, C, Marchioni, S, Marmar, E, Martin, Y, Martinelli, L, Matos, F, Maurizio, R, Mayoral, M, Mazon, D, Menkovski, V, Merle, A, Merlo, G, Meyer, H, Mikszuta-Michalik, K, Molina Cabrera, P, Morales, J, Moret, J, Moro, A, Moulton, D, Muhammed, H, Myatra, O, Mykytchuk, D, Napoli, F, Nem, R, Nielsen, A, Nocente, M, Nowak, S, Offeddu, N, Olsen, J, Orsitto, F, Pan, O, Papp, G, Pau, A, Perek, A, Pesamosca, F, Peysson, Y, Pigatto, L, Piron, C, Poradzinski, M, Porte, L, Putterich, T, Rabinski, M, Raj, H, Rasmussen, J, Ratta, G, Ravensbergen, T, Ricci, D, Ricci, P, Rispoli, N, Riva, F, Rivero-Rodriguez, J, Salewski, M, Sauter, O, Schmidt, B, Schrittweiser, R, Sharapov, S, Sheikh, U, Sieglin, B, Silva, M, Smolders, A, Snicker, A, Sozzi, C, Spolaore, M, Stagni, A, Stipani, L, Sun, G, Tala, T, Tamain, P, Tanaka, K, Tema Biwole, A, Terranova, D, Terry, J, Testa, D, Theiler, C, Thornton, A, Thrysoe, A, Torreblanca, H, Tsui, C, Vaccaro, D, Vallar, M, Van Berkel, M, Van Eester, D, Van Kampen, R, Van Mulders, S, Verhaegh, K, Verhaeghe, T, Vianello, N, Villone, F, Viezzer, E, Vincent, B, Voitsekhovitch, I, Vu, N, Walkden, N, Wauters, T, Weisen, H, Wendler, N, Wensing, M, Widmer, F, Wiesen, S, Wischmeier, M, Wijkamp, T, Wunderlich, D, Wuthrich, C, Yanovskiy, V, and Zebrowski, J

Subjects
Nuclear and High Energy Physics, Tokamak, feedback-control, Nuclear fusion, TCV, EUROfusion, ddc:620, plasmas, Condensed Matter Physics, tokamak, nuclear fusion, QC
Abstract

The tokamak à configuration variable (TCV) continues to leverage its unique shaping capabilities, flexible heating systems and modern control system to address critical issues in preparation for ITER and a fusion power plant. For the 2019–20 campaign its configurational flexibility has been enhanced with the installation of removable divertor gas baffles, its diagnostic capabilities with an extensive set of upgrades and its heating systems with new dual frequency gyrotrons. The gas baffles reduce coupling between the divertor and the main chamber and allow for detailed investigations on the role of fuelling in general and, together with upgraded boundary diagnostics, test divertor and edge models in particular. The increased heating capabilities broaden the operational regime to include T e/T i ∼ 1 and have stimulated refocussing studies from L-mode to H-mode across a range of research topics. ITER baseline parameters were reached in type-I ELMy H-modes and alternative regimes with ‘small’ (or no) ELMs explored. Most prominently, negative triangularity was investigated in detail and confirmed as an attractive scenario with H-mode level core confinement but an L-mode edge. Emphasis was also placed on control, where an increased number of observers, actuators and control solutions became available and are now integrated into a generic control framework as will be needed in future devices. The quantity and quality of results of the 2019–20 TCV campaign are a testament to its successful integration within the European research effort alongside a vibrant domestic programme and international collaborations.

Published
2022

39. Experimental investigation of L- and H-mode detachment via the divertor Thomson scattering at ASDEX Upgrade

Author

M. Cavedon, B. Kurzan, M. Bernert, D. Brida, R. Dux, M. Griener, S. Henderson, E. Huett, T. Nishizawa, T. Lunt, O. Pan, U. Stroth, M. Wischmeier, E. Wolfrum, null the ASDEX Upgrade Team, Cavedon, M, Kurzan, B, Bernert, M, Brida, D, Dux, R, Griener, M, Henderson, S, Huett, E, Nishizawa, T, Lunt, T, Pan, O, Stroth, U, Wischmeier, M, Wolfrum, E, and ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society

Subjects
H-mode, Nuclear and High Energy Physics, divertor Thomson scattering, detachment, divertor, L-mode, Paper, Condensed Matter Physics, ddc
Abstract

The capabilities of the newly installed divertor Thomson Scattering (DTS) diagnostic (Kurzan et al 2021 J. Inst. 16 C09012) at ASDEX Upgrade (AUG) have been demonstrated by measuring 2D electron densities n e and temperatures T e from attached to fully detached divertor conditions in L- and H-mode. The collected dataset is a breakthrough for divertor studies at AUG in which such measurements have been so far missing. Besides highlighting the strengths and limits of the DTS system, this work provides confirmations and new insights into detachment physics. The transition between partial and pronounced detachment correlates with a 2D redistribution of the electron density from the inner to the outer divertor in both L- and H-mode. In pronounced detachment, a strong parallel pressure gradient could be confirmed throughout the complete SOL. Finally, measurements of n e and T e of a stable X-point radiator revealed local temperatures as low as 1 eV within the confined plasma, whereas the pressure is shown to be constant on closed field lines.

Published
2022

40. Model for access and stability of the X-point radiator and the threshold for marfes in tokamak plasmas

Author

U. Stroth, M. Bernert, D. Brida, M. Cavedon, R. Dux, E. Huett, T. Lunt, O. Pan, M. Wischmeier, the ASDEX Upgrade Team, ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, Stroth, U, Bernert, M, Brida, D, Cavedon, M, Dux, R, Huett, E, Lunt, T, Pan, O, and Wischmeier, M

Subjects
disruption control, Nuclear and High Energy Physics, exhaust, Paper, X-point radiator, divertor detachment, marfe, Condensed Matter Physics, ddc
Abstract

Based on particle and energy balances, a reduced model is derived for the physical mechanisms leading to the occurrence of stable and unstable X-point radiators (XPRs), the latter also known as marfes. The leading roles of the neutral deuterium density in the divertor region for initiating XPRs is highlighted. An access condition is formulated whose parameter dependencies are consistent with experimental observations and which could also apply to the process of divertor detachment. With an exponential increase of the recombination rate at low temperature, the XPR becomes magnetohydrodynamically unstable, leading to a marfe and, possibly, to a disruption. A critical density for marfe occurrence is formulated with the upstream density and safety factor as leading parameters, as in the experiment. Marfes are predicted to be more likely in carbon devices than in impurity-seeded plasmas in tungsten devices. The edge plasma parameter domain where marfes occur resembles that used for active marfe avoidance schemes. Both the XPR and marfe occurrence parameter can be used to guide active discharge control.

Published
2022

41. Near- and far scrape-off layer transport studies in detached, small-ELM ASDEX Upgrade discharges by means of EMC3-EIRENE

Author

A. Drenik, D. Silvagni, M. Faitsch, M. Griener, B. Kurzan, M. Wischmeier, O. Pan, T. Lunt, M. Bernert, U. Plank, M. Cavedon, D. Brida, Daniel Carralero, Y. Feng, Albrecht Herrmann, E. Wolfrum, M. Willensdorfer, Heinke Frerichs, P. David, ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, Lunt, T, Frerichs, H, Bernert, M, Brida, D, Carralero, D, Cavedon, M, David, P, Drenik, A, Faitsch, M, Feng, Y, Griener, M, Herrmann, A, Kurzan, B, Pan, O, Plank, U, Silvagni, D, Willensdorfer, M, Wischmeier, M, and Wolfrum, E

Subjects
EMC3-EIRENE, Materials science, Detachment, Tokamak, Power exhaust, Condensed Matter Physics, 01 natural sciences, ddc, 010305 fluids & plasmas, Computational physics, Nuclear Energy and Engineering, ASDEX Upgrade, 0103 physical sciences, 010306 general physics, Transport studies, Layer (electronics)
Abstract

We compare various diagnostics characterizing an ASDEX Upgrade upper single-null discharge to EMC3-EIRENE simulations now including volumetric recombination and main chamber plasma-wall interaction but not yet drifts. The discharge is in a small-ELM regime and is approaching detachment due to a density ramp and nitrogen seeding. Time/ELM averaged upstream density, electron and ion temperature measurements as well as downstream ion saturation current, electron temperature and power flux measurements match the simulation within the error bars before and after reaching detachment, qualifying the code for this regime. Although the Ion Cyclotron Resonance Heating (ICRH) antenna limiters are 35 mm away from the separatrix, i.e. ten times the typical near-SOL power fall-off length λnearq = 3.8 mm, they receive power fluxes of several hundreds of kW exceeding the ones to the outer target in the detached phase and strongly contribute to the particle fueling. This is explained by a substantially larger far-SOL power fall-off length λfarq = 25 mm possibly caused by the small ELMs in the detached phase and the occurrence of a density shoulder.

Published
2020

42. Study of detachment in future ASDEX Upgrade alternative divertor configurations by means of EMC3-EIRENE

Author

M. Wischmeier, U. Plank, M. Bernert, D. Brida, M. Teschke, D. Silvagni, M. Willensdorfer, Y. Feng, P. David, M. Cavedon, O. Pan, E. Wolfrum, M. Faitsch, T. Lunt, I. Zammuto, M. Griener, A. Herrmann, B. Kurzan, ASDEX Upgrade Team, Max Planck Institute for Plasma Physics, Max Planck Society, Lunt, T, Bernert, M, Brida, D, Cavedon, M, David, P, Faitsch, M, Feng, Y, Griener, M, Herrmann, A, Kurzan, B, Pan, O, Plank, U, Silvagni, D, Teschke, M, Willensdorfer, M, Wischmeier, M, Wolfrum, E, and Zammuto, I

Subjects
Nuclear and High Energy Physics, EMC3-EIRENE, Field line, Detachment, Materials Science (miscellaneous), 01 natural sciences, 010305 fluids & plasmas, Snowflake, ASDEX Upgrade, 0103 physical sciences, 010302 applied physics, Physics, Toroid, Divertor, Power exhaust, Mechanics, Plasma, lcsh:TK9001-9401, ddc, X-divertor, Nuclear Energy and Engineering, Heat flux, lcsh:Nuclear engineering. Atomic power, Current (fluid), Alternative divertor configuration
Abstract

ASDEX Upgrade is preparing a hardware modification of its upper divertor in order to study alternative divertor configurations, like the X-divertor (XD) and the snowflake divertor (SF), that are discussed as a possible solution for the power exhaust problem. Experiments characterizing the current upper divertor in single-null (SN) configuration before and during detachment were carried out recently and interpreted by EMC3-EIRENE (Lunt et al., 2020) now including volumetric recombination. In continuation of these studies we here report on further simulations with this code extrapolating these conditions to the future upper divertor. For the same transport parameters, input power and upstream separatrix density for which the outer target (OT) of the SN is attached, the XD and SF show significant detachment at the OT accompanied by a reduction of the parallel heat flux by a factor of more than five. Despite the shallow field line incidence angles in the XD configuration the intrinsic 3D error fields from the current feeds only cause toroidal variations of the power fluxes of the order of 10%. With a hypothetical misalignment of the divertor coils by 3 cm substantial asymmetries in the power deposition profile are found, however, even those vanish when going to detached plasma conditions. In order to fully detach the plasma at the OT in the SF configuration impurities, here in the form of nitrogen, need to be puffed directly into the region of the secondary X-point in the simulation.

Full Text
View/download PDF

43. Compact Radiative Divertor Experiments at ASDEX Upgrade and Their Consequences for a Reactor.

Author

Lunt T, Bernert M, Brida D, David P, Faitsch M, Pan O, Stieglitz D, Stroth U, and Redl A

Abstract

We present a novel concept to tackle the power exhaust challenge of a magnetically confined fusion plasma. It relies on the prior establishment of an X-point radiator that dissipates a large fraction of the exhaust power before it reaches the divertor targets. Despite the spatial proximity of the magnetic X point to the confinement region, this singularity is far away from the hot fusion plasma in magnetic coordinates and therefore allows the coexistence of a cold and dense plasma with a high potential to radiate. In the compact radiative divertor (CRD) the target plates are placed close to this magnetic X point. We here report on high performance experiments in the ASDEX Upgrade tokamak that indicate the feasibility of this concept. Despite the shallow (projected) field line incidence angles of the order of θ_{⊥}=0.2°, no hot spots were observed on the target surface monitored by an IR camera, even at a maximum heating power of P_{heat}=15  MW. And even with the X point located exactly on the target surface and without density or impurity feedback control, the discharge remains stable, the confinement good (H_{98,y2}=1), hot spots absent, and the divertor in a detached state. In addition to its technical simplicity, the CRD scales beneficially to reactor-scale plasmas that would benefit from an increased volume of the confined plasma, more space for breeding blankets, smaller poloidal field coil currents, and-potentially-an increased vertical stability.

Published
2023
Full Text
View/download PDF

44. Viral vectors as a novel tool for clinical and neuropsychiatric research applications.

Author

Wang Y, Hu Z, Ju P, Yin S, Wang F, Pan O, and Chen J

Abstract

Background: A viral vector is a genetically modified vector produced by genetic engineering. As pathogenic genes in the virus are completely or largely eliminated, it is safe to be widely used in multidisciplinary research fields for expressing genes, such as neuroscience, metabolism, oncology and so on. Neuroscience and psychiatry are the most closely related disciplines in either basic research or clinical research, but the application of viral vectors in neuropsychiatry has not received much attention or not been widely accepted., Objective: This article will focus on the application of viral vectors in basic and clinical neuropsychiatric research., Methods: By using viral vectors, scientists can perform neurological labelling, gene expression regulation and physiological manipulation for investigating phenomenon from molecular mechanisms to behaviours. At the same time, to treat mental or neurological disorders, viral vectors can be designed for gene therapy, which alter gene expression levels or repair mutated genes in the brains of patients., Perspective: Viral vectors play an important role in basic research and clinical applications. To further understand brain function and prevent mental and neurological diseases, we hypothesize that viral vectors could be used along with various advanced technologies, such as sequencing and high-throughput expression analysis in the neuroscience research field., Competing Interests: Competing interests: None declared.

Published
2018
Full Text
View/download PDF

45. Evaluation of recombinant monoclonal antibody SVmab1 binding to Na V 1.7 target sequences and block of human Na V 1.7 currents.

Author

Liu D, Tseng M, Epstein LF, Green L, Chan B, Soriano B, Lim D, Pan O, Murawsky CM, King CT, and Moyer BD

Abstract

Identification of small and large molecule pain therapeutics that target the genetically validated voltage-gated sodium channel Na V 1.7 is a challenging endeavor under vigorous pursuit. The monoclonal antibody SVmab1 was recently published to bind the Na V 1.7 DII voltage sensor domain and block human Na V 1.7 sodium currents in heterologous cells. We produced purified SVmab1 protein based on publically available sequence information, and evaluated its activity in a battery of binding and functional assays. Herein, we report that our recombinant SVmAb1 does not bind peptide immunogen or purified Na V 1.7 DII voltage sensor domain via ELISA, and does not bind Na V 1.7 in live HEK293, U-2 OS, and CHO-K1 cells via FACS. Whole cell manual patch clamp electrophysiology protocols interrogating diverse Na V 1.7 gating states in HEK293 cells, revealed that recombinant SVmab1 does not block Na V 1.7 currents to an extent greater than observed with an isotype matched control antibody. Collectively, our results show that recombinant SVmab1 monoclonal antibody does not bind Na V 1.7 target sequences or specifically inhibit Na V 1.7 current., Competing Interests: All authors were full-time employees at Amgen, Inc. at the time the experiments were conducted.

Published
2016
Full Text
View/download PDF

46. The high-resolution crystal structure of human LCAT.

Author

Piper DE, Romanow WG, Gunawardane RN, Fordstrom P, Masterman S, Pan O, Thibault ST, Zhang R, Meininger D, Schwarz M, Wang Z, King C, Zhou M, and Walker NP

Subjects
Cholesterol genetics, Crystallography, X-Ray, Humans, Mutation, Phosphatidylcholine-Sterol O-Acyltransferase metabolism, Protein Binding, Protein Conformation, Signal Transduction, Cholesterol metabolism, Phosphatidylcholine-Sterol O-Acyltransferase chemistry, Phosphatidylcholine-Sterol O-Acyltransferase genetics
Abstract

LCAT is intimately involved in HDL maturation and is a key component of the reverse cholesterol transport (RCT) pathway which removes excess cholesterol molecules from the peripheral tissues to the liver for excretion. Patients with loss-of-function LCAT mutations exhibit low levels of HDL cholesterol and corneal opacity. Here we report the 2.65 Å crystal structure of the human LCAT protein. Crystallization required enzymatic removal of N-linked glycans and complex formation with a Fab fragment from a tool antibody. The crystal structure reveals that LCAT has an α/β hydrolase core with two additional subdomains that play important roles in LCAT function. Subdomain 1 contains the region of LCAT shown to be required for interfacial activation, while subdomain 2 contains the lid and amino acids that shape the substrate binding pocket. Mapping the naturally occurring mutations onto the structure provides insight into how they may affect LCAT enzymatic activity., (Copyright © 2015 by the American Society for Biochemistry and Molecular Biology, Inc.)

Published
2015
Full Text
View/download PDF

47. Design and calibration of high-frequency magnetic probes for the SUNIST spherical tokamak.

Author

Liu Y, Tan Y, Pan O, Ke R, Wang W, and Gao Z

Abstract

A new high-frequency magnetic diagnostic system is designed, installed, and calibrated in the Sino-United Spherical Tokamak (SUNIST) to investigate Alfvén waves (AWs). The system consists of a fixed toroidal array and a movable radial array of high-frequency magnetic probes (HFMPs) with 21 and 60 probes, respectively. Based on the method of vacuum enameled wire wound on ceramic bobbins, the fixed toroidal array is located as near as possible to the plasma and carefully shielded to reduce the attenuation of high-frequency magnetic field. Meanwhile, by using the technology of commercial chip inductors mounted on printed circuit boards, the movable radial array is inserted into a thin quartz tube that allows positioning along radial direction. A Helmholtz coil is utilized to calibrate the effective areas as well as the frequency response of each HFMP. The calibration results are consistent with the calculated results of an equivalent probe-and-cable circuit model. High-frequency magnetic signals related to AW are detected with these HFMPs. These HFMPs are expected to play a key role in analyzing Alfvén eigenmodes excited by AW antenna in the SUNIST.

Published
2014
Full Text
View/download PDF

48. Development of a human antibody tolerant mouse model to assess the immunogenicity risk due to aggregated biotherapeutics.

Author

Bi V, Jawa V, Joubert MK, Kaliyaperumal A, Eakin C, Richmond K, Pan O, Sun J, Hokom M, Goletz TJ, Wypych J, Zhou L, Kerwin BA, Narhi LO, and Arora T

Subjects
Animals, B-Lymphocytes immunology, Humans, Immunoglobulin G immunology, Mice, Mice, Inbred C57BL, T-Lymphocytes immunology, Antibodies immunology, Antibody Formation immunology, Biological Factors immunology, Immune Tolerance immunology
Abstract

We describe a novel human immunoglobulin G2 (IgG2 )-tolerant and immune-competent heterozygous mouse model (Xeno-het) developed by crossbreeding a human Ig-tolerized XenoMouse® with a C57BL/6J wild-type mouse. The Xeno-het mouse expresses both mouse and human immunoglobulin G (IgG) genes, resulting in B-cells expressing human and mouse IgG, and secretion of human and mouse Ig into serum. This model was utilized to evaluate the immunogenicity risk of aggregated and chemically modified human antibodies. The mice were tested for their ability to break tolerance to self-tolerant monomeric antibodies. Aggregates made by mechanical stirring elicited an anti-drug antibody (ADA) response, but did not induce a robust and long-term memory B and T-cell response. Chemically modified antibodies made by oxidation were only weak and transient inducers of an immune response, as measured by a lack of both an ADA response and a B-cell antigen-specific response. Aggregate size was an important characteristic, as specific-sized protein-coated beads were able to elicit an immune response. We propose the use of this model to identify risk factors such as aggregation during manufacturing at early development for an increased potential immunogenicity risk., (© 2013 Wiley Periodicals, Inc. and the American Pharmacists Association.)

Published
2013
Full Text
View/download PDF

49. A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.

Author

Chan JC, Piper DE, Cao Q, Liu D, King C, Wang W, Tang J, Liu Q, Higbee J, Xia Z, Di Y, Shetterly S, Arimura Z, Salomonis H, Romanow WG, Thibault ST, Zhang R, Cao P, Yang XP, Yu T, Lu M, Retter MW, Kwon G, Henne K, Pan O, Tsai MM, Fuchslocher B, Yang E, Zhou L, Lee KJ, Daris M, Sheng J, Wang Y, Shen WD, Yeh WC, Emery M, Walker NP, Shan B, Schwarz M, and Jackson SM

Subjects
Animals, Cholesterol immunology, Crystallography, X-Ray, Macaca fascicularis, Mice, Mice, Inbred C57BL, Mice, Knockout, Proprotein Convertase 9, Proprotein Convertases, Receptors, LDL genetics, Receptors, LDL physiology, Antibodies, Monoclonal immunology, Cholesterol blood, Neutralization Tests, Serine Endopeptidases immunology
Abstract

Proprotein convertase subtilisin/kexin type 9 (PCSK9) regulates serum LDL cholesterol (LDL-C) by interacting with the LDL receptor (LDLR) and is an attractive therapeutic target for LDL-C lowering. We have generated a neutralizing anti-PCSK9 antibody, mAb1, that binds to an epitope on PCSK9 adjacent to the region required for LDLR interaction. In vitro, mAb1 inhibits PCSK9 binding to the LDLR and attenuates PCSK9-mediated reduction in LDLR protein levels, thereby increasing LDL uptake. A combination of mAb1 with a statin increases LDLR levels in HepG2 cells more than either treatment alone. In wild-type mice, mAb1 increases hepatic LDLR protein levels approximately 2-fold and lowers total serum cholesterol by up to 36%: this effect is not observed in LDLR(-/-) mice. In cynomolgus monkeys, a single injection of mAb1 reduces serum LDL-C by 80%, and a significant decrease is maintained for 10 days. We conclude that anti-PCSK9 antibodies may be effective therapeutics for treating hypercholesterolemia.

Published
2009
Full Text
View/download PDF

50. Efficacy of garbanzo and soybean flour in suppression of aberrant crypt foci in the colons of CF-1 mice.

Author

Murillo G, Choi JK, Pan O, Constantinou AI, and Mehta RG

Subjects
Animals, Azoxymethane, Carcinogens, Chemoprevention, Colonic Neoplasms chemically induced, Female, Mice, Precancerous Conditions chemically induced, Cicer, Colonic Neoplasms prevention & control, Flour, Phytotherapy methods, Precancerous Conditions prevention & control, Glycine max
Abstract

Background: Epidemiological studies have reported a low incidence of colon cancer in countries with high legume consumption. Moreover, experimental studies have found that legumes, such as soybeans and pinto beans, have anticancer properties. While garbanzo beans are a rich source of various phytochemicals, they have not been well studied. In the present study, the azoxymethane (AOM)-induced aberrant crypt foci (ACF) in CF-1 mice was utilized as a model to assess and compare the effects of garbanzo flour to that of soy flour., Materials and Methods: Twenty, 5-week-old CF-1 mice were divided into four groups of 5 animals each: 10% garbanzo, 10% soy, 10% mixed (soy and garbanzo flours), and control (rodent chow). Animals received subcutaneous injections of AOM (10-mg/kg B. W.) once a week for two weeks to induce ACF. At week ten, the animals were sacrificed and the colons were scored., Results: There was a 64% (p <0.001) suppression of ACF for animals fed the garbanzo flour, versus an inhibition of 58 and 55% (p<0.001) for the soy and mixed flour groups, respectively., Discussion: These results demonstrate that garbanzo beans possess bioactive compounds capable of inhibiting the formation of pre-cancerous lesions in mice and suggest that, like soybeans, their consumption contributes to a reduction in colon cancer incidence.

Published
2004

Catalog

Books, media, physical & digital resources
See catalog results