Search

Androctonus crassicauda scorpion species lives in nature both as a prey and a predator. So it has venom that can be effective for hunting and protection. It can cause venoming and death by stinging people and animals. It is of great importance to know the ecological characteristics and density of this scorpion species, especially in regions where venoming cases are high. In the present study, Şanlıurfa province, where the scorpion species Androctonus crassicauda is prevalent, was chosen as the research area. 289 samples were collected after field studies in all districts of Şanlıurfa province. Owing to desolated and stony structure, Androctonus crassicauda was observed to be more intensive in Harran district. It was generally found from April to October. The most abundant period of the species is June, July, and August. Considering the seasonal expectation, test results of correlation for a series with non-normal distribution were listed in two options, Kendall'stau_b correlation coefficient and Spearman'srho correlation coefficient. There was a positive correlation of 0,168 (16%) at 1% significance between month and population for the former (Kendall'stau_b) coefficient. A positive correlation of 0,231 (23%) at 1% significance level between month and population for the latter (Spearman'srho) coefficient. In the view of regional expectation, results of correlation test for a non-normal distribution were presented in two options. A negative correlation of 0,099 (9%) was found at 5% significance level between region and population for the former coefficient. There was a negative correlation of 0,128 (12%) at 5% significance level between region and population for the second coefficient. The study revealed a variation between seasons and districts., Androctonus crassicauda akrep türü doğada hem av hem de yırtıcı olarak yaşar. Bu yüzden avlanma ve korunma için etkili olabilecek zehirlere sahiptir. İnsanları ve hayvanları sokarak zehirlenmeye ve ölüme neden olabilmektedir. Özellikle zehirlenme vakalarının yoğun olduğu bölgelerde bu akrep türünün ekolojik özelliklerinin ve yoğunluğunun bilinmesi büyük önem taşımaktadır. Bu çalışmada, araştırma alanı olarak Androctonus crassicauda akrep türünün yaygın olduğu Şanlıurfa ili seçilmiştir. Şanlıurfa ilinin tüm ilçelerinde yapılan saha çalışmaları sonucunda 289 örnek toplanmıştır. Harran ilçesinde ıssız ve taşlı yapısı nedeniyle Androctonus crassicauda'nın daha yoğun olduğu görülmüştür. Genellikle Nisan'dan Ekim'e kadar bulunmuştur. En yoğun olduğu dönem Haziran, Temmuz ve Ağustos aylarıdır. Mevsimsel beklenti gözetilerek ve normal dağılmayan bir seri için yapılan koralesyon testi sonuçları Kendall'stau_b korelasyon katsayısı ve Spearman'srho korelasyon katsayısı şeklinde iki opsiyon şeklinde listelenmiştir. İlk (Kendall'stau_b) katsayı için ay ile popülasyon arasında %1 anlamlılık seviyesine göre 0,168 (%16) pozitif bir korelasyon söz konusudur. İkinci (Spearman'srho) katsayı için ay ile popülasyon arasında %1 anlamlılık seviyesine göre 0,231 (%23) pozitif bir korelasyon olduğu görünmektedir. Bölgesel beklenti gözetilerek ve normal dağılmayan bir seri için yapılan korelasyon testi sonuçları iki opsiyon şeklinde listelenmiştir. Önceki katsayı için bölge ve popülasyon arasında %5 anlamlılık düzeyinde 0,099 (%9) negatif korelasyon bulunmuştur. İkinci katsayı için bölge ve popülasyon arasında %5 anlamlılık düzeyinde 0,128 (%12) negatif korelasyon bulunmaktadır. Bu çalışma mevsimler ve ilçeler arasındaki değişiklikleri ortaya çıkarmaktadır.

Bu çalışmada Lurus kraepelini (von Ubisch, 1922) türü akreplerin zehir bezinin histokimyasal yapısının belirlenmesi amaçlandı. Materyal olarak Isparta’nın Aksu ilçesinden toplanan 50 adet Lurus kraepelini’ye ait telsonlar kullanıldı. Zehir kesesinin histolojik yapısı ve glikoproteinlerin histokimyasal yapısı uygun boyama teknikleri kullanılarak belirlendi. Zehir bezinin genel histolojik yapısında zehir kesesinin iç kısmının bağ dokusundan oluştuğu ve bu bağ dokusu içerisinde zehir salgılayan hücreler, destek hücreleri ve mukus hücrelerinin bulunduğu belirlendi. Histokimyasal boyama yöntemleriyle zehir bezinin sülfatlı ve karboksilli asidik, siyalik asitli, nötr ve asidik mukosubstansa sahip olduğu tespit edilerek zehir bezinin her bölgesindeki glikoproteinlerin farklı karakterlere sahip olduğu anlaşıldı. Sonuç olarak zehir bezinde kitin tabakasının nötr, sülfatlı ve asidik; kas tabakasının ve zehir salgı hücrelerinin nötr; epitel salgı hücrelerinin ise asidik mukosubstansı yoğun olarak içerdiği belirlendi. Buna karşın güçlü sülfatlı, zayıf sülfatlı ve sülfat esterli glikoproteinleri içermediği dikkati çekti., In this study, it was aimed to determine the histochemical structure of the venom gland of Lurus kraepelini (von Ubisch, 1922) scorpions. Telsons belonging to 50 Lurus kraepelini collected from Aksu district of Isparta were used as material. The histological structure of the venom sac and the histochemical structure of the glycoproteins were determined using appropriate staining techniques. In the general histological structure of the venom gland, it was determined that the inner part of the venom sac consisted of connective tissue, and that venom secreting cells, support cells and mucus cells were found in this connective tissue. By histochemical staining methods, it was determined that the venom gland had sulphate and carboxylic acidic, sialic acid, neutral and acidic mucosubstances, and it was understood that the glycoproteins in each region of the venom gland had different characters. As a result, the chitin layer in the venom gland was neutral, sulfated and acidic; neutral of the muscle layer and venom secretion cells; It was determined that epithelial secretory cells contained acidic mucosubstance intensely. On the other hand, it was noted that it did not contain glycoproteins with strong sulfates, weak sulfates and sulfate esters.

Akrepler, Arachnida sınıfında yer alan zehirli arthropodlardan olup, bilinen en eski karasal eklembacaklılardır ve yaşayan fosiller olarak da tanımlanmaktadırlar. Akrepler kendilerine özgü bir takım özelliklere, özel yapılara sahip olmaları ve zehirlenme vakalarına sebep olmaları nedeniyle çeşitli araştırmalara konu olmuştur. Ancak, akreplere özgü bir duyu organı olan ve tarak organı olarak da bilinen pektin organın yapısı hakkında çok fazla bilgi bulunmamaktadır. Bu çalışmada, Protoiurus kraepelini (von Ubisch, 1922) akrebinin tarak organ yapısı ışık mikroskobu ve taramalı elektron mikroskop (SEM) kullanarak çalışılmış, detaylı morfolojik ve histolojik özellikleri belirlenmiştir. Örnekler Eğirdir (Isparta, Türkiye)’de yapılan arazi çalışmalarında toplanamıştır. P. kraepelini’nin tarak organı diğer akreplerde olduğu gibi bir çift olarak mesosomal ikinci segmentin ventrolateralinde yerleşmiş olup genel mimariye uygun olarak marjinal lamella, median lamella ve pektinal dişler olmak üzere üç kısımdan oluşmaktadır. Aynı zamanda bu yapılar üzerinde yer alan duyusal kılları, pektinal dişler üzerindeki peg sensillanın morfolojileri incelenmiştir. Bu çalışmada, ilk kez P. kraepelini’nin tarak organının histolojisi ortaya konulmuş ve yapı - fonksiyon arasındaki bağlantı uyarınca olası fonksiyonları tartışılmıştır. Scorpions are the oldest known terrestrial arthropods of the Arachnida class and are also known as living fossils. Scorpions have been subjected to various researches because they have special properties and unique structure, and they cause cases of poisoning. However, there is not much information about the structure of the pectine organ, a specific sense organ of the scorpion, which is also called sensory comb. In this study, the comb organ structure of Protoiurus kraepelini (von Ubisch, 1922) was studied by using light microscopy and scanning electron microscope (SEM) and detailed morphological and histological features were determined. Some of the comb organs of the P. kraepelini scorpions collected in the field studies from Eğirdir (Isparta, Turkey) were prepared for SEM by using routine methods. A portion of the comb organs were embedded in parafine and sections were taken and stained sections were stained with hematoxylin-eosin and histological features were examined in light microscope. The comb organ of P. kraepelini is located in the ventrolateral part of the mesosomal second segment as in other scorpions and consists of three parts as marginal lamella, median lamella and pectinal teeth in accordance with the general architecture. At the same time, sensory hairs on these structures and peg sensilla on pectinal teeth were examined. In this study, the histology of the comb organ of P. kraepelini was first time demonstrated and its possible functions were discussed in the relationship between structure and function.

Akrepler, Arachnida sınıfında zehirli arthropodlardan olup; örümcekler, keneler veakarlar ile akraba oldukları düşünülmektedir. Ancak; akrepler, tarak organ (pektin) adıverilen duyu organı taşırlar ve bu yapılarıyla diğer akrabalarından ayrılırlar. Buçalışmanın amacı, ışık mikroskobu ve taramalı elektron mikroskop (SEM) kullanarakMesobuthus gibbosus (Brullé, 1832) (Scorpionidae: Buthidae) akrep türünün tarakorganının (pektin) morfolojik ve histolojik özelliklerini belirlemektir. Tarak organıoluşturan dişlerin detaylı morfolojik ve histolojik yapıları rutin yöntemlerle parafinegömülerek, kesitler alınmış ve alınan kesitler hematoksilen-eosin ile boyanarak ışıkmikroskobunda mikrografları kayıt edilmiştir. M. gibbosus’un pektinleri bir çift olarakmesosomal ikinci segmentin ventrolateral yerleşmiş olup, tarak şeklindeki her bir pektinorgan marjinal lamella, farklı sayılardaki median lamella ve dişler olmak üzere üçkısımdan oluşmaktadır. Pektinlerde, çeşitli kutikular duyu kılları ve her bir dişin uçkısmında çok sayıda peg sensilla gözlenmiştir. M. gibbosus’un pektin organından alınanenine kesitlerde her bir peg sensilumun çok sayıda sinir hücresi ile ilişkili olduğugözlenmiştir. Scorpions are venomous arthropods in Arachnida classis; they are thought to be relatedwith the spiders, ticks and mites. However, scorpions have sensory organs called sensorycomb organ (pectine) and their structure are distinctive other relatives. The objective ofthe present study, is to characterize the morphological and histological features ofpectines (sensory comb) organ of scorpion species Mesobuthus gibbosus (Brullé, 1832)(Scorpionidae: Buthidae) were identified by using light microscope and scanning electronmicroscope (SEM). The pectines were prepared by following routine electron microscopeprocedures and routine paraffin methods and the sections were stained by hematoxylineosin stain. The pectines of M. gibbosus are paired sensory organs located on theventrolateral of second segments of mesosoma, the comb like each pectin organ consist ofmarginal lamella, different number of median lamella and teeth. Pectines have severalsensory hairs and peg sensilla of tip of the tooth. The transverse sections of pectinesorgan were observed that each peg sensilum innerved by many sensory neurons.

Leiurus abdullahbayrami Güneydoğu Anadolu bölgesinde yayılış gösteren ve halk sağlığı açısından önemli bir akrep türüdür. Bu çalışma Türkiye için endemik bir değeri olan Leiurus abdullahbayrami' nin sahip olduğu venom içeriğinin aydınlatılmasına odaklanmıştır.Akreplerden ham venom elektostimülasyon tekniği kullanılarak elde edilmiştir. Ham venomun kromotografik olarak ayrımı Yüksek Performans Sıvı Kromatografisi' nde (HPLC) gerçekleştirilmiş ve en az 42 farklı fraksiyon elde edilmiştir. 33, 01 alıkonma zamanına sahip letal ve majör bileşenlerden olan peptid belirlenmiş ve çalışmalara bu peptid ile devam edilmiştir. Peptidin moleküler ağırlığı kütle spektrometresi (MS) ile 6809,55 Da. olarak bulunmuştur. Protein sekanslama çalışmaları Edman degradasyonu yöntemi ile gerçekleştirilmiştir. Asp-N endopeptidaz enzimi ile yıkılarak sekanslanan saf peptidin 64 aminoasit uzunluğuna sahip, 4 disülfid bağı ile paketlenmiş olduğu belirlenmiştir. Tüm dizilim VRDGYIAKPENCVYHCIPDCDTLCKDNGGTGGH CGFKLGHGIACWCNALPDNVGIIVDGVKCHK olarak bulunmuştur. BLAST benzerlik analizi ile peptid dizilimine en yakın dizilim %98' lik oranla Leiurus quinquestriatus habreus' tan saflaştırılan Lqh6 peptidi olarak bulunmuştur. Yapısal özelliklerinden yola çıkılarak elektrofizyolojik çalışmalar Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.5, Nav1.6 ve Nav1.7 kanalları üzerinde gerçekleştirilmiştir. Peptidin özellikle Nav1.1 Nav1.3 ve Nav1.4 kanalları olmak üzere çalışılan tüm Na+ kanalları üzerinde etkili olduğu belirlenmiştir.Bu tez çalışması ile Leiurus abdullahbayrami nedeni ile oluşan zehirlenmelerdeki semptomların aydınlatılması ve mekanizmasının açıklanabilmesi için 33,01 dakika alıkonma zamanına sahip toksik peptidin birincil yapısı aydınlatılmış, elektrofizyolojik teknikler ile etkin olduğu iyon kanalı belirlenmiş ve bilgilerimize göre Leiurus abdullahbayrami türünden ilk saflaştırılan peptid olması nedeni ile Lab1 olarak adlandırılmıştır. Leiurus abdullahbayrami is a kind of scorpion spreading in the Southestarn part of Turkey and important for public health. This study focused on illuminating the venom content of Leiurus abdullahbayrami, an endemic value for Turkey.Crude venom was obtained by electrostimulation technique from scorpions. Chromatographic separation of crude venom was performed on High Performance Liquid Chromatography (HPLC) and at least 42 different fractions were obtained. The peptide has 33,01 RT, lethal and major was determined. Studies were continued with this peptide. The molecular weight of the peptide was determined by mass spectrometry (MS) to 6809.55 Da. Protein sequencing studies were performed by Edman degradation method. It was determined that the pure peptide sequenced by digestion with Asp-N endopeptidase enzyme has a length of 64 amino acids and packaged with 4 disulfide bonds. All sequences were found as VRDGYIAKPENCVYHCIPDCDTLCKDNGGTGGHCGFKLGHGIAC WCNALPDNVGIIVDGVKCHK. By BLAST similarity analysis, the closest sequence to peptide sequence was found as 98% of Lqh6 peptide purified from Leiurus quinquestriatus habreus. From the structural characteristics, electrophysiological studies were carried out on the channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.5, Nav1.6 and Nav1.7. Peptide was found effective on all type of Na+ channel types. Particularly effective on Nav1.1 Nav1.3 and Nav1.4 channels.In this thesis study, the primary structure of toxic peptide with a retention time of 33.01 minutes was elucidated in order to clarify the mechanism and the illumination of the symptoms,electrophysiological techniques are effective in determining ion channels of poisoning caused by Leiurus abdullahbayrami. For our information, it is called Lab1 with the reason that it is the first purified peptide from Leiurus abdullahbayrami. 53

Calchas nordmanni yakın zamana kadar Artvin-Erzurum çevresinde endemik olduğu sanılan fakat son zamanlardaki çalışmalarla Türkiye’nin bir çok bölgesinde ve bazı Yunan adalarında bulunduğu ortaya çıkan Iuridae familyasına ait bir akrep türüdür. Günümüzde antibiyotiklere direnç kazanan bakterilerin neden olduğu enfeksiyonların önemli halk sağlığı problemlerinden birisi olduğu bilinmektedir. Bu çalışma; akrep venomunun antibakteriyal etkinliğinin belirlenmesi üzerine odaklanmıştır. Bu amaçla, seçilen klinik önemi olan bakterilere karşı ham venomun antibakteriyal etkinliği belirlenmiştir. Ardından; yüksek performans sıvı kromatografisinde fraksiyonlarınmıştır. Bu fraksiyonların Salmonella typhimirium, Klebsiella pneumoniae, Pseudomonas aeruginosa, Proteus vulgaris, Staphylococcus aureus, Bacillus cereus, Bacillus subtilis ve Micrococcus luteus bakterileri üzerinde agar difüzyon yöntemi kullanılarak antibakteriyal aktiviteleri araştırılmıştır. En geniş inhibisyon zonuna sahip olan Bacillus cereus’a ait çalışmalar bir adım daha ileri taşınmış ve yüksek performans sıvı kromatografisinde yeniden fraksiyonlanarak etkin peptid/peptidler bulunmaya çalışılmıştır. Aktivitesi belirlenen pikler arasında en geniş inhibisyon zonuna sahip olan 21.3 dakika alıkonma süreli fraksiyon olmuştur. Bu fraksiyon Trici-Tricine jel elektroforezinde yürütülmüş ve molekül ağırlığının 3,4 kDa ile 6,2 kDa arasında olduğu belirlenmiştir. Bu çalışma, Calchas nordmanni venomunun elektroforetik profilini ve seçilen bakterilere karşı antibakteriyal etkili bileşenlerin varlığını ilk kez bildirmektedir. Elde edilen sonuçların yeni antibiyotiklerin tasarımında yardımcı olması beklenmektedir. Calchas nordmanni that was thought to be endemic to Artvin-Erzurum region till recent studies claimed that it also exists in lots of regions in Turkey and some Greek Islands, is a species of scorpion from Iuridae family. Nowadays, it is known that infections, which are caused by antibiotic resistant bacteria, are one of the serious public health problems. Because the new antibacterial molecules to control these bacteria are required all over the world, this study is focused to define the antibacterial activity of scorpion’s venom. For this purpose, crude venom’s antibacterial activity against clinically impostatnt bacteria was determined. Then they were separated to one minute fractions by high performance liquid chromatography. The antibacterial activities of these fractions on Salmonella typhimirium, Klebsiella pneumoniae, Pseudomonas aeruginosa, Proteus vulgaris, Staphylococcus aureus, Bacillus cereus, Bacillus subtilis and Micrococcus luteus bacteria were determined by using agar diffusion method. The studies on Bacillus cereus, that has the widest inhibition zone, were researched one step more and they were studied to find the active peptides peak by peak fractionation on high performance liquid chromatography. The fraction which has 21.3 minutes retention time, was the peak, that has the widest inhibition zone, between the peaks which activities have been determined. This fraction was analyzed by Trici-Tricine gel electrophoresis and its molecular weights determined between 3.4 and 6.2 kDa. This study declares the electrophoretic profile of Calchas nordmanni's venom and the presence of antibacterial active components against to chosen bacterias, to the world literatures for the first time.

Androctonus crassicauda Doğu Anadolu Bölgesi ve Güneydolu Anadolu Bölgesi'nde yaygın olarak bulunan Buthidae familyasına ait bir akrep türüdür. Androctonus crassicauda taş altlarında, harabeler, ev, ahır gibi insana yakın yerlerde yaşaması ile ülkemizde akrep zehirlenmelerine neden olan türler arasında ilk sırayı almaktadır. Bu çalışma Androctonus crassicauda akrebinde bulunan proteolitik enzimlerin araştırılması ve polivalent akrep antivenomunun, venomun proteolitik aktivitesine olan etkisinin araştırılması üzerine odaklanmıştır.Bu amaçla Androctonus crassicauda ham venomu yüksek performans sıvı kromatografisi kullanılarak bileşenlerine ayrılmıştır. Ham venoma ait fraksiyonların proteolitik aktiviteleri sodyum dodesil sülfat poliakrilamid jel elektroforezinde zimogram yöntemiyle belirlenmiştir. Proteolitik aktivite çalışmalarında substrat olarak jelatin ve kazein kullanılmıştır. Farklı dozlarda antivenomla karıştırılmış ham venomdan oluşan örnekler ile gerçekleştirilen elektroforez çalışmalarında antivenomun, ham venomda bulunan jelatinolitik etkili peptidlerin aktivitesini inhibe ettiği belirlenmiştir. Antivenomun ham venoma ait fraksiyonlarda ise jelatinolitik aktiviteyi kısmen etkilediği belirlenmiştir.Anahtar kelimeler: Androctonus crassicauda, akrep, venom, antivenom, proteolitik aktivite. Androctonus crassicauda is a scorpion species from the family Buthidae, which can be extensively found in the East and South East Regions of Anatolia. Because of the Androctonus crassicauda species share the same habitats with humans, such places as under stones, ruins, houses and barns, it has been placed to the top of the scorpion envenomation in our country. This study is focused on the investigation of the proteolytic activity of peptides from the venom of a scorpion Androctonus crassicauda and Androctonus crassicauda polivalent antivenom effects proteolytic activity of Androctonus crassicauda scorpion venom.To this end, crude venom compenents of Androctonus crassicauda seperated using High Performance Liquid Chromatography. Proteolytic activities of the fraction that belong to crude venom were identified with sodium dodeciyl sulphate polyacrylamide gel electroforesis zymogram methods. Different two substrate were used at the studies. The substrates are gelatin and casein. Studies carried out with the samples that mixed various doses of antivenom and also the samples belong to crude venom. And according to identified the peptides that have to gelatinolitic effect in venom were inhibited by antivenom. Antivenom partly impress to gelatinolytic activity on fractions belong to crude venom.Key words: Androctonus crassicauda, venom, antivenom, proteolitic activity, scorpion? 87

Tez (Doktora) -- Kırıkkale Üniversitesi 86980 …

Mevcut araştırma, Muğla ili ve civarında dağılış gösteren akrep türlerini belirleyip Türkiye akrep faunası'na katkıda bulunmak amacıyla yapılmıştır. Bu amaçla, 2004, 2005 ve 2009 yıllarında çalışma alanına düzenlenen araştırma gezilerinde 15 lokaliteden toplam 65 örnek toplanmıştır. Örnekler morfolojik karakterler açısından değerlendirilerek istatistiksel analize tabi tutulmuştur.Araştırma sonucunda, çalışma sahasında 3 familyaya ait 3 türün (Buthidae familyasından Mesobuthus gibbosus, Iuridae familyasından Iurus dufoureius ve Euscorpiidae familyasından Euscorpius carpathicus) dağılış gösterdiği tespit edilmiştir. Ayrıca bu türlerle ilgili bazı biyo-ekolojik bilgiler verilmiştir.Anahtar kelimeler: Türkiye, Muğla, akrep, fauna, Mesobuthus gibbosus, Iurus dufoureius, Euscorpius carpathicus. This study has been carried out in order to determine species of scorpions which are distributed in Muğla and its vicinity to contribute to the knowledge of Turkish Scorpiofauna. It was organized many zoological expeditions in the years 2004, 2005 and 2009, collected 65 scorpion specimens from 15 localities. The specimens were evaluated in view points of the morphological characters. The obtained data were analysed statistically.In conclusion of the study, 3 species belonging to 3 families (Mesobuthus gibbosus belonging Buthidae, Iurus dufoureius belonging to Iuridae and Euscorpius carpathicus belonging to Euscorpiidae) have distribution in the examined area. Additionally, some biological and ecological observation data have been given.Key Words: Turkey, Muğla, scorpion, fauna, Mesobuthus gibbosus, Iurus dufoureius, Euscorpius carpathicus. 63

Bu araştırma, Dilek Yarımadası Milli Parkı'nın akrep faunasını saptamak amacıyla 2004-2005 yılları arasında yarımadaya düzenlenen araştırma gezileri sırasında, dört lokaliteden elde edilen toplam 63 akrep örneği incelenmiş ve üç familyaya bağlı üç türün yarımadada yayılış gösterdiği saptanmıştır. Belirlenen türler Buthidae familyasından Mesobuthus gibbosus, Euscorpiidae familyasından Euscorpius sp. "carpathicus complex" ve Iuridae familyasından Iurus dufoureius asiaticus'tur. Bildirilen türler Dilek Yarımadası için ilk kayıtlardır., This study was done in order to establish the scorpion fauna of Dilek Peninsula National Park in 2004 and 2005. A total of 63 specimens were collected from four different localities and three species belong to three families were established. The species are Mesobuthus gibbosus in Buthidae; Euscorpius sp. "carpathicus complex" in Euscorpiidae and Iurus dufoureius asiaticus in Iuridae. The species are new records for Dilek Peninsula.

Çalışma Dağmarmara'da yüksekliği 600-1000 m arasında değişen çam, meşe, kestane, yanmış orman ve mera olmak üzere beş farklı biyotopta toprak içine yerleştirilen etilen glikollü tuzaklarla 2003 Mayıs-Ekim aylarında gerçekleştirilmiştir. Toplam 27 örnek tuzak kurulan alanlardan sadece yanmış orman ve meşe biyotoplarından elde edilmiştir. Tuzağa düşen erkek bireylerin sayısı dişilerden fazla olduğu (Erkek/Dişi= 19/8), dişilerin aktifliğinin erkeklere göre yıl içinde daha erken aylarda başladığı ve ağustos ayında ise her iki eşeyin de aktifliğinin en üst seviyede olduğu tesbit edilmiştir (Yakalanma sıklığı erkekte %18,5, dişide %33,3, toplam %51,8)., Studies have been carried out in five different biotopes such as pines, oaks, chestnut trees, burned forest and grasses by using pitfall traps that contain ethylene glycole during the period of May-October, 2003. The biotopes were located between 600-1000 m altitude from sea level, and a total of 27 specimens were collected only from the burned forest and oak biotopes. Males were more commonly caught throughout the six months (Bias, Male/Female= 19/8). The females become active earlier in the year than males and it has been found out that both male and female activity make peak in the month of august (Frequency of capturing individuals in males 18.5%, females 33.3%, totally 51.8%).

Tez (Yüksek Lisans) -- Kırıkkale Üniversitesi 78635 …