Search

Overexpression of DHCR24 does not significantly alter the mRNA levels of TNFα, BDNF, HMOX1, and NQO1 in the whole mouse striatum after middle cerebral artery occlusion. GAPDH-normalized TNFα, BDNF, HMOX1, and NQO1 mRNA levels in the whole mouse striatum determined using qPCR do not indicate changes in the striatum between DHCR24 overexpressing and control lentivirus-transduced mice after tMCAO. Mean ± SEM, n = 6. (PDF 228 kb)

Mitochondrial diseases are generally caused by genetic variants that may affect cell function during the process of energy generation: right from the start of protein translocation to the fatty acid degradation by beta-oxidation (β-oxidation). The main objective of this PhD thesis is to study genetic variants that cause mitochondrial diseases and also to understand the disease pathogenesis of a known disease using the induced pluripotent stem cell (iPSC) method, a revolutionary approach in regenerative medicine. In the first study, we carried out a long-term follow up of six metabolic diseased patients and subsequently we performed a carrier frequency study of the identified carnitine palmitoyl transferase 1A (CPT1A) gene variant in the Finnish population. We identified a novel homozygous variant c.1364A>C (p.Lys455Thr) in exon 12 of the CPT1A gene. No carriers of the variant c.1364A>C were detected upon minisequencing of 150 control samples but the allele frequency of CPT1A variant in global population is 0.0002142 (ExAC Browser) whereas in the Finnish population (6614 allele number) the frequency is 0.001966. The identified variant was predicted to cause improper folding of the CPT1A protein, which leads to its degradation. All patients were treated with a high-carbohydrate and a low fat diet. In the second study, we focused on the human DnaJ (Hsp40 homolog) subfamily C, member 19 (DNAJC19) deficiency. Our studies showed that it causes early onset dilated cardiomyopathy syndrome (DCMA). This is the first report of a genetic defect in the mitochondrial protein, DNAJC19, outside of the Canadian Dariusleut Hutterite population. This defect is characterized by an unusual aetiology for an early onset recessively inherited dilated cardiomyopathy that is associated with ataxia and male genital anomalies. Sequencing of the human DNAJC19 gene revealed a homozygous single nucleotide (A) deletion in exon 6 that cause a frameshift and lead to the premature termination of the protein. In the third study, the pathogenesis of retinopathy in long-chain acyl-CoA dehydrogenase deficiency (LCHADD) was studied using iPSC technology. Retinopathy is an unusual manifestation of LCHADD, as mitochondrial fatty acid β-oxidation (FAβO) has not been considered to play a major role in the metabolism of the retina. Among all defects of mitochondrial FAβO, only long-chain acyl-CoA dehydrogenase (LCHAD) and mitochondrial trifunctional protein (TFP) deficiencies have developed pigmentary retinopathy and peripheral neuropathy. We elucidated how a genetic variant in the FAβO cycle can disrupt the retinal pigment epithelium (RPE) that can eventually lead to blindness. In addition, we developed a new in vitro cell model; iPSC clones were generated from LCHADD patient fibroblasts and further differentiated into RPE cells. Several changes were observed in patient RPE cells such as decreased cell size, lower pigmentation and irregular pattern of morphology. Electron microscopy analysis showed an accumulation of a few melanosomes, more melanolysosomes, and large sized lipid droplets in patient RPE cells. Furthermore, increased levels of triglycerides in patient RPE cells were observed upon mass spectrometric analysis. We concluded that all these changes had contributed to the disruption of the RPE layer that leads to blindness in LCHAD deficiency patients. Finally, the research done for this thesis succeeded in identifying novel variants in CPT1A and DNAJC19 genes in Finnish patients. Our long-term follow up studies on CPT1A deficiency can help patients in better diagnosis, which further helps clinicians to identify the genetic cause. We also found a novel phenotype with DNAJC19 deficiency. Further we established the groundwork to understand the pathogenesis of retinopathy in LCHADD patients using an advanced method that helps to study in depth pathogenesis mechanism. Monien ihmisten päivittäiseen ruokavalioon kuuluu rasvaa sisältäviä elintarvikkeita, kuten juustoa, maitoa, voita ja öljyä. Rasva imeytyy verenkiertoon ja kulkeutuu eri ruumiinosiin ja kudoksiin tuottamaan energiaa. Kun kaloreiden tarve on täytetty, ylimääräinen rasva varastoituu triglyserideiksi rasvakudokseen. Glukoosi on tärkein energianlähde, mutta kun glukoositasot ovat alhaiset (esimerkiksi paaston tai sairauden aikana), varastoidut rasvat muuntuvat energiaksi rasvahappojen beetaoksidaatioksi kutsutussa prosessissa, joka tapahtuu mitokondrioina tunnetuissa soluelimissä. Mitokondriot ovat solujen voimaloita, jotka muuntavat energian adenosiinitrifosfaatiksi (ATP) kutsutuksi polttoaineeksi. Geenit puolestaan ovat sukupolvelta toiselle periytyvää DNA-ainesta, joka välittyy lapsille vanhempien kautta. Jos geenin muodostuessa tapahtuu mutaatio, mekanismi häiriintyy ja aiheuttaa sairauden. Tämä opinnäyte tutkii kolmea suomalaisväestössä esiintyvää geenivirhettä, jotka liittyvät rasvahappojen beetaoksidaatioon. Ne vaikuttavat pitkäketjuisten rasvahappojen hajottamiseen ja proteiinien kuljettamiseen mitokondrioihin. Kaksi ensimmäistä geenivirhettä ovat karnitiinipalmityylitransferaasi 1 A (CPT1A) ja DNAJC19. Nämä geenivirheet todetaan yleensä vastasyntyneillä ja taaperoikäisillä lapsilla (toiseen ikävuoteen mennessä), ja niihin liittyviä oireita ovat esimerkiksi alhainen verenpaine, oksentelu ja kohtaukset. Biokemiallisten veri- ja virtsakokeiden jälkeen potilailta otettiin veri- ja ihonäytteitä (lupa saatu) DNA:n eristämistä ja geenivirheiden toteamista varten. Suomalaisväestössä havaittu mutaatio on c. 1364A>C (p.Lys455Thr) CPT1A-geenin eksonissa 12. Diagnoosin jälkeen geeniä kantavat potilaat noudattivat vähärasvaista ruokavaliota, joka paransi heidän metabolisia arvojaan. DNAJC19 on ensimmäinen raportoitu mitokondrion proteiinien geenivirhe kanadalaisen Dariusleut-hutteriittiväestön ulkopuolella. Se aiheuttaa varhain puhkeavan dilatoivan kardiomyopatian ja ataksian. Yhden nukleotidin puute (A) johtaa proteiinin terminaatioon. Kolmas tutkittu geeni liittyy pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasi (LCHAD) -entsyymiin, joka osallistuu rasvahappojen beetaoksidaatioon auttamalla pitkäketjuisten rasvahappojen hajottamista. LCHAD:n puutos aiheuttaa sokeuteen johtavaa retinopatiaa. LCHAD-potilaiden retinopatian tutkimiseen käytettiin kantasolutekniikkaa, jolla tuotettiin ihmisen indusoituja pluripotentteja kantasoluja (hiPSC) potilaiden ihosoluista käyttämällä neljää merkittävää transkriptiotekijää. Kyseiset hiPSC:t erilaistetaan edelleen verkkokalvon pigmenttiepiteeleiksi (RPE), jotka ovat tärkeitä näkökyvylle. Morfologiset aineistot, elektronimikroskopia ja massaspektrometria paljastivat lipidikertymiä potilaiden RPE-soluissa. Tämä viittaa siihen, että lipidikertymät saattavat vaikuttaa LCHAD-puutosta sairastavien potilaiden retinopatiaan.

Drug discovery and development from its very onset up to market approval is a long process lasting 10-15 years. New research tools are needed to accelerate and rationalize this process. Ocular drug research still relies heavily on animal testing with rabbits and other rodents. Computational methods and cell culture models are promising tools for early pharmacokinetic studies and may partly replace the animals in pharmacokinetic and toxicological studies. Computational methods are initially based on experimental data, but thereafter their application is straightforward and they can be used to reduce, partly replace and refine further experimental studies. Similarly, cell culture models may enable absorption and toxicity testing of drug candidates with continuously growing cells of human origin, and thereby reduce the need for animal experiments. The cornea is the main route of ocular drug absorption after topical administration, and the corneal epithelium is the most important barrier to drug permeation. Membrane transporter proteins play an important role in the general pharmacokinetics and toxicology. However, their role in ocular pharmacokinetics is still poorly understood. Based on literature analysis many ocular drugs seem to be substrates of transporters, but the expression of these proteins in the eye is largely unknown. The goal of this work was to develop and evaluate cellular and computational tools for ocular pharmacokinetics and toxicology, and to characterise the active drug transporters in the corneal epithelium. The expression of monocarboxylate transporters and ATP-binding cassette (ABC) class efflux proteins was studied in the corneal epithelium and human corneal epithelial (HCE) cell model. Human corneal epithelium expressed monocarboxylate transporters 1 and 4 (MCT1 and MCT4), efflux transporters multidrug resistance-associated protein 1 and 5 (MRP1 and MRP5), and breast cancer resistance protein (BCRP). Cultured human corneal epithelial cells over-expressed several ABC class efflux proteins and MCT1 and MCT4. The functionality of efflux and monocarboxylate transport was demonstrated in HCE cells and in the rabbit cornea ex vivo. The MTT test is a widely used cytotoxicity test in cell research. It was demonstrated that substrates and inhibitors of ABC class efflux proteins may interfere with the MTT test, presumably by inhibiting dye efflux from the cells. This may lead to an underestimation of toxicity in the MTT test. Quantitative structure property relationship (QSPR) models are commonly used in early drug discovery to predict ADME properties of novel compounds. Multivariate analysis was used to develop QSPR models for in silico prediction of the corneal permeability. Two factors, the distribution coefficient (logD7.4 /logD8.0) and hydrogen binding potential, were shown to be the parameters that determine the transcorneal permeability of a compound. These models were able to predict intracameral steady state drug concentrations in rabbit eyes. In conclusion, the new in silico QSPR model can make reliable predictions for passive drug permeability in the cornea, while the HCE model seems to over-express some membrane transporters as compared to the normal human corneal epithelium. Even if these investigated methods have some restrictions they are still very useful tools for drug discovery purposes. Solu- ja ATK-menetelmät silmälääketutkimuksen työkaluina. Uusia tutkimusmenetelmiä tarvitaan tehostamaan lääkekehitystä, joka kestää noin 10 15 vuotta ennen kuin uusi lääkeaine pääsee potilaskäyttöön. Lääkekehitystyössä käytetään edelleen runsaasti eläinkokeita, joten tarve vaihtoehtoisten eettisesti parempien tutkimusmenetelmien kehittämiseen on suuri. Solut ja ATK-menetelmät ovat käyttökelpoisia lääkekehityksen alkuvaiheessa, kun tarvitaan nopeita menetelmiä uusien lääkeainemolekyylien arvioinnissa. Näiden menetelmien avulla voidaan valita lupaavimmat uudet lääkekandidaatit jatkotutkimuksiin eläimissä ja ihmisissä. Silmätippoja käytetään yleisesti silmätautien hoidossa, mutta vain alle 5 % annoksesta imeytyy silmään. Lääkeaineen imeytymistä rajoittaa erityisesti sarveiskalvon pinnassa oleva tiivis epiteelisolukko. Tässä väitöskirjatyössä kehitettiin laskennallisia malleja ennustamaan lääkeaineiden imeytymistä sarveiskalvon läpi silmään. Kehitetyt laskentamallit kertovat, miten lääkeaineen rakenne vaikuttaa sen imeytymiseen. Kemiallisesta rakenteesta laskemalla voitiin ennustaa lääkeaineen imeytyminen silmään tietokoneen avulla lähes yhtä tarkasti kuin kokeellisten koe-eläintutkimusten avulla. Uutta laskentamenetelmää voidaan käyttää silmälääkkeiden kehityksen apuvälineenä ja osin koe-eläinkokeita korvaavana menetelmänä. Väitöskirjatyössä tutkittiin myös lääkeaineiden imeytymisen mekanismeja sarveiskalvon epiteelissä. Ihmisen silmän pinnan epiteelistä löydettiin lääkekuljetukseen vaikuttavia proteiineja. Silmälääkkeiden imeytymistutkimuksiin aiemmin kehitetyn solukasvatusmallin havaittiin myös ilmentävän näitä proteiineja, mutta enemmän kuin normaali silmä. Lääkeaineen turvallisuuden osoittaminen on edellytys lääkeaineen hyväksymiselle potilaskäyttöön. Lääkeaineiden turvallisuustestauksessa käytetään laajasti MTT-menetelmää ja soluja. Tässä työssä havaittiin, että kemikaaleja soluista ulos pumppaavat proteiinit voivat vääristää MTT-menetelmän tuloksia aliarvioiden testiaineiden soluille aiheuttamaa haittaa. Tämä on tärkeä tieto ja syytä ottaa huomioon tätä testiä käytettäessä.

Androgens control a variety of developmental processes that create the male phenotype and are important for maintaining male fertility and normal functions of tissues and organs that are not directly involved in procreation. Androgen receptor (AR) that mediates the biological actions of androgens is a member of the nuclear receptor superfamily of ligand-inducible transcription factors. Although AR was cloned over 15 years ago, the mechanisms by which it regulates gene expression are not well understood. A growing body of in vitro experimental evidence suggests that a complex network of proteins is involved in the androgen-dependent transcriptional regulation. However, the process of AR-dependent transcriptional regulation under physiological conditions is largely elusive. In the present study, a series of experiments were performed, including quantitative chromatin immunoprecipitation (ChIP) assays, to investigate AR-mediated transcription process using living prostate cancer cells. Our results show that the loading of AR and recruitment of coactivators and RNA polymerase II (Pol II) to both the promoter and enhancer of AR target genes are a transient and cyclic event that in addition to hyperacetylation, also involves dynamic changes in methylation, phosphorylation of core histone H3 in androgen-treated LNCaP cells. The dynamics of testosterone (T)-induced loading of AR onto the proximal promoters of the genes clearly differed from that loaded onto the distal enhancers. Significantly, more holo-AR was loaded onto the enhancers than the promoters, but the principal Pol II transcription complex was assembled on the promoters. By contrast, the pure antiandrogen bicalutamide (CDX) complexed to AR elicited occupancy of the PSA promoter, but was unable to load onto the PSA enhancer and was incapable of recruiting Pol II, coactivators and following changes of covalent histone modifications. The partial antagonist cyproterone acetate (CPA) and mifepristone (RU486) were capable of promoting AR loading onto both the PSA promoter and enhancer at a comparable efficiency with androgen in LNCaP cells expressing mutant AR. However, CPA- and RU486-bound AR not only recruited Pol II and coactivator p300 and GRIP1 onto the promoter and enhancer, but also recruited the corepressor NCoR onto the promoter as efficiently as CDX. In addition, we demonstrate that both proteasome and protein kinases are implicated in AR-mediated transcription. Even though proteasome inhibitor MG132 and protein kinase inhibitor DRB (5, 6-Dichlorobenzimidazole riboside) can block ligand-dependent accumulation of PSA mRNA with same efficiency, their use results in different molecular profiles in terms of the formation of AR-mediated transcriptional complex. Collectively, these results indicate that transcriptional activation by AR is a complicated process, which includes transient loading of holo-AR and recruitment of Pol II and coregulators accompanied by a cascade of distinct covalent histone modifications; This process involves both the promoter and enhancer elements, as well as other general components of the cell machineries e.g. proteasome and protein kinase; The pure antiandrogen CDX and the partial antagonist CPA and RU486 exhibit clearly different profiles in terms of their ability to induce the formation of AR-dependent transcriptional complexes and the histone modifications associated with the target genes in human prostate cancer cells. Finally, by using quantitative RT-PCR to compare the expression of sixteen AR co-regulators in prostate cancer cell lines, xenografts, and clinical prostate cancer specimens we suggest that AR co-regulators protein inhibitor of activated STAT1 (PIAS1) and steroid receptor coactivator 1(SRC1) could be involved in the progression of prostate cancer. Miessukuhormonireseptorin toiminta geenien luennan säätelyssä Miessukuhormonit eli androgeenit, testosteroni ja 5±-dihydotestosteroni, saavat aikaan miehisten sukupuoliominaisuuksien kehittymisen ja ne liittyvät vahvasti sekä normaaliin että pahanlaatuiseen eturauhasen kasvuun. Kaikkien eturauhassyöpien kasvu on aluksi androgeeniriippuvaista ja niiden kasvua voidaan hillitä androgeenivaikutusta salpaamalla käyttämällä androgeenien synteettisiä vastavaikuttajia, antiandrogeeneja. Valitettavasti antiandrogeenien vaikutus yleensä heikkenee ja häviää ajan myötä eikä syytä tähän ilmiöön tunneta. Androgeenireseptori (AR) on solunsisäinen valkuaisaine (proteiini), joka sitoo miessukuhormoneja ja välittää niiden biologiset vaikutukset. AR on geenien luentaa säätelevä transkriptiotekijä, joka tunnistaa ja sitoutuu kohdegeeniensä säätelyalueille perimässä, kun miessukuhormonia on tarjolla. Vaikka AR:n aminohappojärjestys selvitettiin jo yli 15 vuotta sitten, sen vaikutusmekanismien yksityiskohtia, erityisesti antiandrogeenien toimintamekanismeja, ei vielä tunneta kunnolla. Viimeaikaiset tutkimustulokset osoittavat, että jotta androgeenit voivat säädellä kohdekudostensa, kuten eturauhasen, geenien luentaa, tarvitaan AR:n ja miessukuhormonin lisäksi useita muita valkuaisaineita, ns. apureseptoreja, koregulaattoreita. Väitöskirjatutkimuksen tavoitteena oli selvittää tarkemmin AR:n toimintaa eturauhasen gee-nien säätelyssä. Työssä kehitettiin ns. kromatiini-immunosaostus (ChIP) -tekniikka, jonka avulla tutkittiin AR:n ja sen koregulaattoreiden sitoutumista mallikohdegeenin PSA (prostataspesifinen antigeeni) -geenin säätelyalueille. Seerumin PSA:n mittauksilla on tärkeä merkitys eturauhassyövän ennustetekijänä. Mallisysteeminä käytettiin viljeltyjä ihmisen eturauhassyöpäsoluja, joita oli kasvatettu luonnollisten androgeenien tai erilaisten synteettisten antiandrogeenien kanssa. Kun soluja käsiteltiin testosteronilla, AR sitoutui hyvin nopeasti PSA-geenin säätelyalueille ja se toi perässään RNA-polymeraasi II lisäksi joukon aktivoivia koregulaattoreitä, mm. GRIP1- ja p300-proteiineja, muodostaen ns. transkriptiokompleksin. Koregulaattorit muuttivat hyvin nopeasti perimän rakennetta paremmin luettavaan muotoon, mikä näkyi DNA:ta pakkaavien histonien kovalenttien modifikaatioiden, asetylaation, metylaation ja fosforylaation, selvinä muutoksina. Tutkimuksessa havaittiin yllättäen myös, että solutuman proteiinien aktiivinen hajottaminen ns. proteasomikompleksin kautta on välttämätöntä myös androgeenivaikituksen välittymiseksi: AR rekrytoi proteasomin yksiköitä ja proteasomi-inhibiitori MG132 salpasi AR:n transkriptiokompleksin muodostumisen. Kun soluja käsiteltiin eturauhassyövän hoitodossa käytettävällä ei-steroidaalisella antiandrogeenilla, bikalutamidilla, AR sitoutui huonosti PSA-geeniin eikä se pystynyt muodostamaan transkriptiokompleksiaan, joten geeniä ei luettu. Sen sijaan havaittiin geeninluentaa vaimentavien ns. korepressoriproteiinien NCoR:n ja SMRT:n sitoutuminen. Mielenkiintoista oli myös, että toisentyyppinen antiandrogeeni, syproteroniasetaatti, ei estänyt AR-transkriptiokompleksin muodostumista, vaikka NCoR:n ja SMRT:n samanaikainen sitoutuminen oli mitattavissa. Tulokset osoittavat, että AR säätelee geenien luentaa monimutkaisen prosessien kautta, joissa AR:n ja RNA-polymeraasi II:n lisäksi erilaiset koregulaattorit sitoutuvat dynaamisesti, jonka seurauksena on perimän histonien epigeneettisen koodiin ohjelmoimituminen uudelleen. Geenien luennan säätelyn perustutkimuksellisen näkökulman lisäksi työn avaamat uudet tulokset ovat tärkeitä myös uusien eturauhassyövän hoitoon soveltuvien antiandrogeenien lääkekehityksen kannalta.