Search

Your search keyword '"Spellerberg, Barbara"' showing total 19 results
Start Over Author "Spellerberg, Barbara" Publisher mdpi ag
19 results on '"Spellerberg, Barbara"'

2. The Designed Pore-Forming Antimicrobial Peptide C14R Combines Excellent Activity against the Major Opportunistic Human Pathogen Pseudomonas aeruginosa with Low Cytotoxicity

Author

Mildenberger, Vanessa, primary, Alpízar-Pedraza, Daniel, additional, Martell-Huguet, Ernesto M., additional, Krämer, Markus, additional, Bolotnikov, Grigory, additional, Otero-Gonzalez, Anselmo J., additional, Weil, Tanja, additional, Rodriguez-Alfonso, Armando, additional, Preising, Nico, additional, Ständker, Ludger, additional, Vogel, Verena, additional, Spellerberg, Barbara, additional, Kissmann, Ann-Kathrin, additional, and Rosenau, Frank, additional

Published
2024
Full Text
View/download PDF

3. Cm-p5 Peptide Dimers Inhibit Biofilms of Candida albicans Clinical Isolates, C. parapsilosis and Fluconazole-Resistant Mutants of C. auris

Author

Amann, Valerie, primary, Kissmann, Ann-Kathrin, additional, Mildenberger, Vanessa, additional, Krebs, Imke, additional, Perez-Erviti, Julio A., additional, Martell-Huguet, Ernesto M., additional, Otero-Gonzalez, Anselmo J., additional, Morales-Vicente, Fidel, additional, Rodríguez-Castaño, Gina P., additional, Firacative, Carolina, additional, Rodríguez, Armando, additional, Ständker, Ludger, additional, Weil, Tanja, additional, Spellerberg, Barbara, additional, Stenger, Steffen, additional, and Rosenau, Frank, additional

Published
2023
Full Text
View/download PDF

4. Aptamers as Novel Binding Molecules on an Antimicrobial Peptide-Armored Composite Hydrogel Wound Dressing for Specific Removal and Efficient Eradication of Pseudomonas aeruginosa

Author

Kraemer, Markus, primary, Bellion, Magali, additional, Kissmann, Ann-Kathrin, additional, Herberger, Tilmann, additional, Synatschke, Christopher V., additional, Bozdogan, Anil, additional, Andersson, Jakob, additional, Rodriguez, Armando, additional, Ständker, Ludger, additional, Wiese, Sebastien, additional, Stenger, Steffen, additional, Spellerberg, Barbara, additional, Gottschalk, Kay-Eberhard, additional, Cetinkaya, Ahmet, additional, Pietrasik, Joanna, additional, Weil, Tanja, additional, and Rosenau, Frank, additional

Published
2023
Full Text
View/download PDF

5. Identification and Characterization of Three New Antimicrobial Peptides from the Marine Mollusk Nerita versicolor (Gmelin, 1791)

Author

Rodriguez, Armando, primary, Martell-Huguet, Ernesto M., additional, González-García, Melaine, additional, Alpízar-Pedraza, Daniel, additional, Alba, Annia, additional, Vazquez, Antonio A., additional, Grieshober, Mark, additional, Spellerberg, Barbara, additional, Stenger, Steffen, additional, Münch, Jan, additional, Kissmann, Ann-Kathrin, additional, Rosenau, Frank, additional, Wessjohann, Ludger A., additional, Wiese, Sebastian, additional, Ständker, Ludger, additional, and Otero-Gonzalez, Anselmo J., additional

Published
2023
Full Text
View/download PDF

8. A Polyclonal SELEX Aptamer Library Allows Differentiation of Candida albicans, C. auris and C. parapsilosis Cells from Human Dermal Fibroblasts

Author

Kneißle, Katharina, primary, Krämer, Markus, additional, Kissmann, Ann-Kathrin, additional, Xing, Hu, additional, Müller, Franziska, additional, Amann, Valerie, additional, Noschka, Reiner, additional, Gottschalk, Kay-Eberhard, additional, Bozdogan, Anil, additional, Andersson, Jakob, additional, Weil, Tanja, additional, Spellerberg, Barbara, additional, Stenger, Steffen, additional, and Rosenau, Frank, additional

Published
2022
Full Text
View/download PDF

9. Group B Streptococcal Colonization in African Countries: Prevalence, Capsular Serotypes, and Molecular Sequence Types

Author

Shabayek, Sarah, Ferrieri, Patricia, Spellerberg, Barbara, Lütticken, Rudolf, and Nobbs, Angela H.

Subjects
Microbiology (medical), Colonization, neonatal infections, General Immunology and Microbiology, Kolonisation, Streptococcus agalactiae, Review, colonization, Infectious Diseases, DDC 570 / Life sciences, ddc:570, Neonatal infections, Immunology and Allergy, Medicine, Molecular Biology, group B streptococci, perinatal
Abstract

Streptococcus agalactiae or group B streptococcus (GBS) is a commensal of the gastrointestinal and genitourinary tracts of healthy women and an important cause of neonatal invasive infections worldwide. Transmission of bacteria to the newborn occurs at birth and can be prevented by intrapartum antibiotic prophylaxis. However, this not available in resource limited settings in Africa, which carries a particular high burden of disease. Serotype based vaccines are in development and present a suitable alternative to prevent neonatal infections. To be able to assess vaccine efficacy, knowledge and surveillance of GBS epidemiological data are required. This review summarizes investigations about the serotype distribution and the multi-locus sequence types (MLST) found in different African countries. While most serotypes and MLST data are comparable to findings from other continents, some specific differences exist. Serotype V is predominant among colonizing maternal strains in many different African countries. Serotypes that are rarely detected in western industrialized nations, such as serotypes VI, VII and IX, are prevalent in studies from Ghana and Egypt. Moreover, some specific MLST sequence types that seem to be more or less unique to Africa have been detected. However, overall, the data confirm that a hexavalent vaccine can provide broad coverage for the African continent and that a protein vaccine could represent a promising alternative., publishedVersion

Published
2021

10. Albumin Microspheres as “Trans-Ferry-Beads” for Easy Cell Passaging in Cell Culture Technology

Author

Favella, Patrizia, primary, Sihler, Susanne, additional, Raber, Heinz, additional, Kissmann, Ann-Kathrin, additional, Krämer, Markus, additional, Amann, Valerie, additional, Kubiczek, Dennis, additional, Baatz, Jennifer, additional, Lang, Fabian, additional, Port, Fabian, additional, Gottschalk, Kay-Eberhard, additional, Mayer, Daniel, additional, Spellerberg, Barbara, additional, Stenger, Steffen, additional, Müller, Ingrid, additional, Weil, Tanja, additional, Ziener, Ulrich, additional, and Rosenau, Frank, additional

Published
2021
Full Text
View/download PDF

11. BSA Hydrogel Beads Functionalized with a Specific Aptamer Library for Capturing Pseudomonas aeruginosa in Serum and Blood

Author

Krämer, Markus, primary, Kissmann, Ann-Kathrin, additional, Raber, Heinz Fabian, additional, Xing, Hu, additional, Favella, Patrizia, additional, Müller, Ingrid, additional, Spellerberg, Barbara, additional, Weil, Tanja, additional, Kubiczek, Dennis, additional, Sihler, Susanne, additional, Ziener, Ulrich, additional, and Rosenau, Frank, additional

Published
2021
Full Text
View/download PDF

12. FluCell-SELEX Aptamers as Specific Binding Molecules for Diagnostics of the Health Relevant Gut Bacterium Akkermansia muciniphila

Author

Raber, Heinz Fabian, primary, Kubiczek, Dennis Horst, additional, Bodenberger, Nicholas, additional, Kissmann, Ann-Kathrin, additional, D’souza, Deena, additional, Xing, Hu, additional, Mayer, Daniel, additional, Xu, Pengfei, additional, Knippschild, Uwe, additional, Spellerberg, Barbara, additional, Weil, Tanja, additional, and Rosenau, Frank, additional

Published
2021
Full Text
View/download PDF

14. Antimicrobial Activity of Cyclic-Monomeric and Dimeric Derivatives of the Snail-Derived Peptide Cm-p5 against Viral and Multidrug-Resistant Bacterial Strains

Author

González-García, Melaine, primary, Morales-Vicente, Fidel, additional, Pico, Erbio Díaz, additional, Garay, Hilda, additional, Rivera, Daniel G., additional, Grieshober, Mark, additional, Raluca Olari, Lia, additional, Groß, Rüdiger, additional, Conzelmann, Carina, additional, Krüger, Franziska, additional, Zech, Fabian, additional, Prelli Bozzo, Caterina, additional, Müller, Janis A., additional, Zelikin, Alexander, additional, Raber, Heinz, additional, Kubiczek, Dennis, additional, Rosenau, Frank, additional, Münch, Jan, additional, Stenger, Steffen, additional, Spellerberg, Barbara, additional, Franco, Octavio L., additional, Rodriguez Alfonso, Armando A., additional, Ständker, Ludger, additional, and Otero-Gonzalez, Anselmo J., additional

Published
2021
Full Text
View/download PDF

15. New Antibacterial Peptides from the Freshwater Mollusk Pomacea poeyana (Pilsbry, 1927)

Author

González García, Melaine, Rodríguez, Armando, Alba, Annia, Vázquez, Antonio A., Morales Vicente, Fidel E., Pérez-Erviti, Julio, Spellerberg, Barbara, Stenger, Steffen, Grieshober, Mark, Conzelmann, Carina, Münch, Jan, Raber, Heinz, Kubiczek, Dennis, Rosenau, Frank, Wiese, Sebastian, Ständker, Ludger, Otero-González, Anselmo, European Union (EU), and Horizon 2020

Subjects
Peptide antibiotics, animal structures, Peptidantibiotikum, lcsh:QR1-502, Pomacea poeyana, lcsh:Microbiology, antimicrobial peptides, DDC 570 / Life sciences, Antibacterial agents, antibacterial activity, ddc:570, Antimicrobial peptides, ddc:610, Antibacterial activity, DDC 610 / Medicine & health
Abstract

Antimicrobial peptides (AMPs) are biomolecules with antimicrobial activity against a broad group of pathogens. In the past few decades, AMPs have represented an important alternative for the treatment of infectious diseases. Their isolation from natural sources has been widely investigated. In this sense, mollusks are promising organisms for the identification of AMPs given that their immune system mainly relies on innate response. In this report, we characterized the peptide fraction of the Cuban freshwater snail Pomacea poeyana (Pilsbry, 1927) and identified 37 different peptides by nanoLC-ESI-MS-MS technology. From these peptide sequences, using bioinformatic prediction tools, we discovered two potential antimicrobial peptides named Pom-1 (KCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQ) and Pom-2 (KEIERAGQRIRDAIISAAPAVETLAQAQKIIKGG). Database search revealed that Pom-1 is a fragment of Closticin 574 previously isolated from the bacteria Clostridium tyrobutyrium, and Pom-2 is a fragment of cecropin D-like peptide first isolated from Galleria mellonella hemolymph. These sequences were chemically synthesized and evaluated against different human pathogens. Interestingly, structural predictions of both peptides in the presence of micelles showed models that comprise two alpha helices joined by a short loop. The CD spectra analysis of Pom-1 and Pom-2 in water showed for both structures a high random coil content, a certain content of &alpha, helix and a low &beta, sheet content. Like other described AMPs displaying a disordered structure in water, the peptides may adopt a helical conformation in presence of bacterial membranes. In antimicrobial assays, Pom-1 demonstrated high activity against the Gram-negative bacteria Pseudomonas aeruginosa and moderate activity against Klebsiella pneumoniae and Listeria monocytogenes. Neither of the two peptides showed antifungal action. Pom-1 moderately inhibits Zika Virus infection but slightly enhances HIV-1 infectivion in vitro. The evaluation of cell toxicity on primary human macrophages did not show toxicity on THP-1 cells, although slight overall toxicity was observed in high concentrations of Pom-1. We assume that both peptides may play a key role in innate defense of P. poeyana and represent promising antimicrobial candidates for humans.

Published
2020

18. Deciphering Streptococcal Biofilms

Author

Yadav, Puja, primary, Verma, Shalini, additional, Bauer, Richard, additional, Kumari, Monika, additional, Dua, Meenakshi, additional, Johri, Atul Kumar, additional, Yadav, Vikas, additional, and Spellerberg, Barbara, additional

Published
2020
Full Text
View/download PDF

Catalog

Books, media, physical & digital resources
See catalog results