Search

Your search keyword '"Oliva, Maria Luiza"' showing total 8 results
Start Over Author "Oliva, Maria Luiza" Journal biochemical and biophysical research communications
8 results on '"Oliva, Maria Luiza"'

5. Angiostatin-like molecules are generated by snake venom metalloproteinases

Author

Ho, Paulo Lee, primary, Serrano, Solange Maria de Toledo, additional, Chudzinski-Tavassi, Ana Marisa, additional, da Silva, Ana Maria Moura, additional, Mentele, Reinhard, additional, Caldas, Cristina, additional, Oliva, Maria Luiza Vilela, additional, Batista, Isabel de Fátima Correia, additional, and de Oliveira, Maria Leonor Sarno, additional

Published
2002
Full Text
View/download PDF

8. Primary Structure of Dioclea glabraTrypsin Inhibitor, DgTI, a Bowman–Birk Inhibitor

Author

Bueno, Norlene R, Fritz, Hans, Auerswald, Ennes A, Mentele, Reinhart, Sampaio, Misako, Sampaio, Claudio A.M, and Oliva, Maria Luiza V

Abstract

A novel serine proteinase inhibitor, DgTI, was purified from Dioclea glabraseeds by acetone precipitation, and ion-exchange and reverse phase chromatography. The inhibitor belongs to the Bowman–Birk family, and its primary sequence, determined by Edman degradation and mass spectrometry, of 67 amino acids is: SSGPCCDRCRCTKSEPPQCQCQDVRLNSCHSACEACVCSHSMPGLCSCLDITHFCHEPCKSSGDDED. Although two reactive sites were determined by susceptibility to trypsin (Lys13and His40), the inhibitory function was assigned only to the first site. The inhibitor forms a 1:1 complex with trypsin, and Kiis 0.5 × 10−9M. Elastase, chymotrypsin, kallikreins, factor Xa, thrombin, and plasmin were not inhibited. By its properties, DgTI is a Bowman–Birk inhibitor with structural and inhibitory properties between the class of Bowman–Birk type I (with a fully active second reactive site), and Bowman–Birk type II (devoid of second reactive site).

Published
1999
Full Text
View/download PDF

Catalog

Books, media, physical & digital resources
See catalog results