1. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels
- Author
-
Jalali, Amir, Bosmans, Frank, Amininasab, Mehriar, Clynen, Elke, Cuypers, Eva, Zaremirakabadi, Abbas, Sarbolouki, Mohammad-Nabi, Schoofs, Liliane, Vatanpour, Hossein, and Tytgat, Jan
- Subjects
TOXINS ,ANTIGENS ,XENOPUS laevis ,METABOLITES - Abstract
Abstract: In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na
+ channels expressed in Xenopus laevis oocytes (Nav 1.2/β1 , Nav 1.5/β1 , para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200nM of OD1 (EC50 =80±14nM) while Nav 1.2/β1 still was not affected at concentrations up to 5μM. Nav 1.5/β1 was influenced at micromolar concentrations. [Copyright &y& Elsevier]- Published
- 2005
- Full Text
- View/download PDF